Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicA-HicB |
Location | 5786771..5787393 | Replicon | chromosome |
Accession | NZ_CP118142 | ||
Organism | Pseudomonas chlororaphis strain ATCC 17809 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | - |
Locus tag | PUP81_RS26180 | Protein ID | WP_106696706.1 |
Coordinates | 5786771..5786953 (+) | Length | 61 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | PUP81_RS26185 | Protein ID | WP_106698998.1 |
Coordinates | 5786986..5787393 (+) | Length | 136 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PUP81_RS26155 (PUP81_26155) | 5782377..5783864 | + | 1488 | WP_106696708.1 | sensor domain-containing diguanylate cyclase | - |
PUP81_RS26160 (PUP81_26160) | 5783872..5784090 | + | 219 | WP_274346761.1 | cysteine-rich CWC family protein | - |
PUP81_RS26165 (PUP81_26165) | 5784124..5784816 | + | 693 | WP_025804997.1 | 16S rRNA pseudouridine(516) synthase | - |
PUP81_RS26170 (PUP81_26170) | 5785168..5786052 | + | 885 | WP_009047472.1 | alpha/beta hydrolase | - |
PUP81_RS26180 (PUP81_26180) | 5786771..5786953 | + | 183 | WP_106696706.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
PUP81_RS26185 (PUP81_26185) | 5786986..5787393 | + | 408 | WP_106698998.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
PUP81_RS26190 (PUP81_26190) | 5787639..5788106 | + | 468 | WP_106696705.1 | GAF domain-containing protein | - |
PUP81_RS26195 (PUP81_26195) | 5788236..5789150 | + | 915 | WP_124323665.1 | SGNH/GDSL hydrolase family protein | - |
PUP81_RS26200 (PUP81_26200) | 5789184..5790962 | - | 1779 | WP_124323664.1 | GGDEF and EAL domain-containing protein | - |
PUP81_RS26205 (PUP81_26205) | 5791198..5792091 | - | 894 | WP_173678573.1 | LysR family transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6810.12 Da Isoelectric Point: 11.6709
>T272815 WP_106696706.1 NZ_CP118142:5786771-5786953 [Pseudomonas chlororaphis]
VNSRYLIGQIVADGWYLVRVRGSHHPFRHPSKPGLVTVPHPKKDLLRKTAISILKQALLM
VNSRYLIGQIVADGWYLVRVRGSHHPFRHPSKPGLVTVPHPKKDLLRKTAISILKQALLM
Download Length: 183 bp
Antitoxin
Download Length: 136 a.a. Molecular weight: 14657.65 Da Isoelectric Point: 4.4710
>AT272815 WP_106698998.1 NZ_CP118142:5786986-5787393 [Pseudomonas chlororaphis]
MLYPIAISMGDDEHAWGVEVPDIPGCFSAGDDLDDAMAMAREAIEGHFEILAEDGAAIPPANKVTLHAANPQYAGRTWAL
IDIDVTKYLGKAQKLNITLPGYLLNRIDEYVLHHPEAKSRSGFLASAALKVLQQD
MLYPIAISMGDDEHAWGVEVPDIPGCFSAGDDLDDAMAMAREAIEGHFEILAEDGAAIPPANKVTLHAANPQYAGRTWAL
IDIDVTKYLGKAQKLNITLPGYLLNRIDEYVLHHPEAKSRSGFLASAALKVLQQD
Download Length: 408 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|