Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicA-HicB |
Location | 4957041..4957660 | Replicon | chromosome |
Accession | NZ_CP118142 | ||
Organism | Pseudomonas chlororaphis strain ATCC 17809 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | A0A3G7DMG3 |
Locus tag | PUP81_RS22430 | Protein ID | WP_009048155.1 |
Coordinates | 4957041..4957223 (+) | Length | 61 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | A0A285IZU0 |
Locus tag | PUP81_RS22435 | Protein ID | WP_007923747.1 |
Coordinates | 4957259..4957660 (+) | Length | 134 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PUP81_RS22415 (PUP81_22415) | 4952776..4953324 | + | 549 | WP_124304749.1 | YniB family protein | - |
PUP81_RS22420 (PUP81_22420) | 4953665..4955824 | + | 2160 | WP_164486009.1 | AAA family ATPase | - |
PUP81_RS22425 (PUP81_22425) | 4956468..4956749 | + | 282 | WP_124304747.1 | hypothetical protein | - |
PUP81_RS22430 (PUP81_22430) | 4957041..4957223 | + | 183 | WP_009048155.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
PUP81_RS22435 (PUP81_22435) | 4957259..4957660 | + | 402 | WP_007923747.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
PUP81_RS22440 (PUP81_22440) | 4958226..4958975 | - | 750 | WP_124304746.1 | hypothetical protein | - |
PUP81_RS22445 (PUP81_22445) | 4959069..4959704 | - | 636 | WP_124304745.1 | response regulator transcription factor | - |
PUP81_RS22450 (PUP81_22450) | 4959701..4961590 | - | 1890 | WP_124304744.1 | PAS domain S-box protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6799.98 Da Isoelectric Point: 10.9678
>T272814 WP_009048155.1 NZ_CP118142:4957041-4957223 [Pseudomonas chlororaphis]
VQSRQLIKELEAAGWVLERVTGSHHLFKHPYRPETVPVPHPKKDLPRGTVRAIQKLAGLI
VQSRQLIKELEAAGWVLERVTGSHHLFKHPYRPETVPVPHPKKDLPRGTVRAIQKLAGLI
Download Length: 183 bp
Antitoxin
Download Length: 134 a.a. Molecular weight: 14579.54 Da Isoelectric Point: 4.6017
>AT272814 WP_007923747.1 NZ_CP118142:4957259-4957660 [Pseudomonas chlororaphis]
VQYPICIEWGDEHTATGIQIPDIPGAVTAGDTFEAAYSAAIEIAHVMLEELAREGQAIPLPSPTGTHRANPDFEGMGWGM
LDIDITPYLGKTEKVNVTLPGYVIQRIDRFVREHNIKSRSSFLADAAMEKLGR
VQYPICIEWGDEHTATGIQIPDIPGAVTAGDTFEAAYSAAIEIAHVMLEELAREGQAIPLPSPTGTHRANPDFEGMGWGM
LDIDITPYLGKTEKVNVTLPGYVIQRIDRFVREHNIKSRSSFLADAAMEKLGR
Download Length: 402 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3G7DMG3 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A285IZU0 |