Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PumAB/upstrm_HI1419-dnstrm_HI1420 |
Location | 4942404..4942989 | Replicon | chromosome |
Accession | NZ_CP118142 | ||
Organism | Pseudomonas chlororaphis strain ATCC 17809 |
Toxin (Protein)
Gene name | PumA | Uniprot ID | A0A3G7C0N8 |
Locus tag | PUP81_RS22370 | Protein ID | WP_025804099.1 |
Coordinates | 4942404..4942697 (+) | Length | 98 a.a. |
Antitoxin (Protein)
Gene name | PumB | Uniprot ID | A0A3G7CJP2 |
Locus tag | PUP81_RS22375 | Protein ID | WP_025804100.1 |
Coordinates | 4942699..4942989 (+) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PUP81_RS22350 (PUP81_22350) | 4937438..4937836 | - | 399 | WP_016702749.1 | carboxymuconolactone decarboxylase family protein | - |
PUP81_RS22355 (PUP81_22355) | 4938049..4939293 | - | 1245 | WP_124323954.1 | M20/M25/M40 family metallo-hydrolase | - |
PUP81_RS22360 (PUP81_22360) | 4939387..4940511 | - | 1125 | WP_124323953.1 | diguanylate cyclase | - |
PUP81_RS22365 (PUP81_22365) | 4940774..4942168 | + | 1395 | WP_124323952.1 | VOC family protein | - |
PUP81_RS22370 (PUP81_22370) | 4942404..4942697 | + | 294 | WP_025804099.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PUP81_RS22375 (PUP81_22375) | 4942699..4942989 | + | 291 | WP_025804100.1 | putative addiction module antidote protein | Antitoxin |
PUP81_RS22380 (PUP81_22380) | 4943403..4943990 | - | 588 | WP_063429489.1 | hypothetical protein | - |
PUP81_RS22385 (PUP81_22385) | 4944118..4945194 | - | 1077 | WP_124323951.1 | lipocalin-like domain-containing protein | - |
PUP81_RS22390 (PUP81_22390) | 4945184..4947664 | - | 2481 | WP_124325843.1 | FtsX-like permease family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 98 a.a. Molecular weight: 10837.49 Da Isoelectric Point: 10.7289
>T272813 WP_025804099.1 NZ_CP118142:4942404-4942697 [Pseudomonas chlororaphis]
MEYEILQTTVFAQWHTRLRDLRARIAIARRIERASAGNLGDVKNLGGGLSEMRVNRGAGYRIYFTVRGNTLIVLLLGGDK
STQPADICQARSLAKEF
MEYEILQTTVFAQWHTRLRDLRARIAIARRIERASAGNLGDVKNLGGGLSEMRVNRGAGYRIYFTVRGNTLIVLLLGGDK
STQPADICQARSLAKEF
Download Length: 294 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3G7C0N8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3G7CJP2 |