Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PumAB/COG3657-dnstrm_HI1420 |
Location | 6265958..6266547 | Replicon | chromosome |
Accession | NZ_CP118141 | ||
Organism | Pseudomonas chlororaphis strain ATCC 17814 |
Toxin (Protein)
Gene name | PumA | Uniprot ID | - |
Locus tag | PUP70_RS28475 | Protein ID | WP_007924097.1 |
Coordinates | 6266248..6266547 (-) | Length | 100 a.a. |
Antitoxin (Protein)
Gene name | PumB | Uniprot ID | - |
Locus tag | PUP70_RS28470 | Protein ID | WP_009045810.1 |
Coordinates | 6265958..6266251 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PUP70_RS28445 (PUP70_28445) | 6261673..6262131 | + | 459 | WP_053262808.1 | GNAT family N-acetyltransferase | - |
PUP70_RS28450 (PUP70_28450) | 6262385..6263041 | + | 657 | WP_007924093.1 | DedA family protein | - |
PUP70_RS28455 (PUP70_28455) | 6263047..6263856 | + | 810 | WP_053262809.1 | zinc-dependent peptidase | - |
PUP70_RS28460 (PUP70_28460) | 6264121..6264648 | + | 528 | WP_003228599.1 | inorganic diphosphatase | - |
PUP70_RS28465 (PUP70_28465) | 6265456..6265842 | + | 387 | WP_053262810.1 | hypothetical protein | - |
PUP70_RS28470 (PUP70_28470) | 6265958..6266251 | - | 294 | WP_009045810.1 | putative addiction module antidote protein | Antitoxin |
PUP70_RS28475 (PUP70_28475) | 6266248..6266547 | - | 300 | WP_007924097.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PUP70_RS28480 (PUP70_28480) | 6266719..6267168 | + | 450 | WP_053262811.1 | DUF3828 domain-containing protein | - |
PUP70_RS28485 (PUP70_28485) | 6267193..6268203 | - | 1011 | WP_173613368.1 | NAD(P)-dependent alcohol dehydrogenase | - |
PUP70_RS28490 (PUP70_28490) | 6268261..6268560 | - | 300 | WP_007924100.1 | helix-turn-helix transcriptional regulator | - |
PUP70_RS28495 (PUP70_28495) | 6268627..6269715 | - | 1089 | WP_053262813.1 | copper-containing nitrite reductase | - |
PUP70_RS28500 (PUP70_28500) | 6269942..6270184 | + | 243 | WP_007924102.1 | exodeoxyribonuclease VII small subunit | - |
PUP70_RS28505 (PUP70_28505) | 6270181..6271068 | + | 888 | WP_053262814.1 | (2E,6E)-farnesyl diphosphate synthase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11326.08 Da Isoelectric Point: 10.6613
>T272811 WP_007924097.1 NZ_CP118141:c6266547-6266248 [Pseudomonas chlororaphis]
MIEIKQTATFMEWENRLKDSRARALIAARIFRLANGLAGDVSPVGEGVSELRIHYGPGYRVYFQQRGLQLVILLCGGDKS
RQSRDIELAKYLARRWSRS
MIEIKQTATFMEWENRLKDSRARALIAARIFRLANGLAGDVSPVGEGVSELRIHYGPGYRVYFQQRGLQLVILLCGGDKS
RQSRDIELAKYLARRWSRS
Download Length: 300 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|