Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicA-HicB |
Location | 1772510..1773132 | Replicon | chromosome |
Accession | NZ_CP118141 | ||
Organism | Pseudomonas chlororaphis strain ATCC 17814 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | A0A285HEJ8 |
Locus tag | PUP70_RS08015 | Protein ID | WP_053259927.1 |
Coordinates | 1772950..1773132 (-) | Length | 61 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | A0A285HET1 |
Locus tag | PUP70_RS08010 | Protein ID | WP_009042564.1 |
Coordinates | 1772510..1772917 (-) | Length | 136 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PUP70_RS07990 (PUP70_07990) | 1767685..1768347 | - | 663 | WP_053259924.1 | NAD(P)-binding domain-containing protein | - |
PUP70_RS07995 (PUP70_07995) | 1768450..1769340 | + | 891 | WP_053260051.1 | LysR family transcriptional regulator | - |
PUP70_RS08000 (PUP70_08000) | 1769578..1771356 | + | 1779 | WP_053259925.1 | sensor domain-containing phosphodiesterase | - |
PUP70_RS08005 (PUP70_08005) | 1771390..1772304 | - | 915 | WP_053259926.1 | SGNH/GDSL hydrolase family protein | - |
PUP70_RS08010 (PUP70_08010) | 1772510..1772917 | - | 408 | WP_009042564.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
PUP70_RS08015 (PUP70_08015) | 1772950..1773132 | - | 183 | WP_053259927.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
PUP70_RS08020 (PUP70_08020) | 1774196..1774912 | + | 717 | WP_053259928.1 | molecular chaperone | - |
PUP70_RS08025 (PUP70_08025) | 1775023..1775982 | + | 960 | WP_053259929.1 | fimbrial protein | - |
PUP70_RS08030 (PUP70_08030) | 1776106..1776666 | + | 561 | Protein_1583 | HipA domain-containing protein | - |
PUP70_RS08035 (PUP70_08035) | 1776781..1777524 | - | 744 | WP_053259931.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6873.18 Da Isoelectric Point: 11.1084
>T272809 WP_053259927.1 NZ_CP118141:c1773132-1772950 [Pseudomonas chlororaphis]
VDSRYLIGQIVADGWYLVRVRGSHHHFKHPHKPGLVTVPHPKKDLLRKTAISILKQALLM
VDSRYLIGQIVADGWYLVRVRGSHHHFKHPHKPGLVTVPHPKKDLLRKTAISILKQALLM
Download Length: 183 bp
Antitoxin
Download Length: 136 a.a. Molecular weight: 14698.72 Da Isoelectric Point: 4.5911
>AT272809 WP_009042564.1 NZ_CP118141:c1772917-1772510 [Pseudomonas chlororaphis]
MLYPIAISMGDDEHAWGVEVPDIPGCFSAGDDLDDAMAMAREAIEGHFEILAEDGAPIPHANKVTLHAANPRYAGCTWAL
IDIDVTKYLGKAQKLNITLPGYLLNRIDEYVLHHPEAKSRSGFLASAALKVLQQD
MLYPIAISMGDDEHAWGVEVPDIPGCFSAGDDLDDAMAMAREAIEGHFEILAEDGAPIPHANKVTLHAANPRYAGCTWAL
IDIDVTKYLGKAQKLNITLPGYLLNRIDEYVLHHPEAKSRSGFLASAALKVLQQD
Download Length: 408 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A285HEJ8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A285HET1 |