Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 6033694..6034322 | Replicon | chromosome |
Accession | NZ_CP118140 | ||
Organism | Pseudomonas chlororaphis strain ATCC 336632 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | PUP57_RS27150 | Protein ID | WP_038576104.1 |
Coordinates | 6033694..6034092 (-) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | PUP57_RS27155 | Protein ID | WP_081359896.1 |
Coordinates | 6034092..6034322 (-) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PUP57_RS27120 (PUP57_27120) | 6028932..6029207 | + | 276 | WP_038576112.1 | hypothetical protein | - |
PUP57_RS27125 (PUP57_27125) | 6029414..6029590 | + | 177 | WP_164486677.1 | hypothetical protein | - |
PUP57_RS27130 (PUP57_27130) | 6029795..6030292 | + | 498 | WP_081363157.1 | PAAR domain-containing protein | - |
PUP57_RS27135 (PUP57_27135) | 6030296..6031030 | + | 735 | WP_081359899.1 | alpha/beta hydrolase | - |
PUP57_RS27140 (PUP57_27140) | 6031027..6031551 | + | 525 | WP_081359898.1 | hypothetical protein | - |
PUP57_RS27145 (PUP57_27145) | 6031687..6033636 | + | 1950 | WP_081359897.1 | alkaline phosphatase D family protein | - |
PUP57_RS27150 (PUP57_27150) | 6033694..6034092 | - | 399 | WP_038576104.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
PUP57_RS27155 (PUP57_27155) | 6034092..6034322 | - | 231 | WP_081359896.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
PUP57_RS27160 (PUP57_27160) | 6034600..6035577 | + | 978 | WP_081359895.1 | type I-F CRISPR-associated endonuclease Cas1f | - |
PUP57_RS27165 (PUP57_27165) | 6035574..6038990 | + | 3417 | WP_081359894.1 | type I-F CRISPR-associated helicase Cas3f | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14886.17 Da Isoelectric Point: 7.2433
>T272805 WP_038576104.1 NZ_CP118140:c6034092-6033694 [Pseudomonas chlororaphis]
MLKYMLDTNICIFTIKNKPERVREAFNRQHGRLCISSVTLMELIYGAEKSAAPERNLSVIEGFVARLEVLAYDYEAAIHS
GQLRAELARAGTPIGPYDQLIAGHARSQGLVLVTNNVREFERVPGLRIEDWL
MLKYMLDTNICIFTIKNKPERVREAFNRQHGRLCISSVTLMELIYGAEKSAAPERNLSVIEGFVARLEVLAYDYEAAIHS
GQLRAELARAGTPIGPYDQLIAGHARSQGLVLVTNNVREFERVPGLRIEDWL
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|