Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-YafN |
| Location | 4691759..4692278 | Replicon | chromosome |
| Accession | NZ_CP118140 | ||
| Organism | Pseudomonas chlororaphis strain ATCC 336632 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | PUP57_RS21040 | Protein ID | WP_081360541.1 |
| Coordinates | 4691759..4692040 (-) | Length | 94 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | A0A1H3UB71 |
| Locus tag | PUP57_RS21045 | Protein ID | WP_009044432.1 |
| Coordinates | 4692030..4692278 (-) | Length | 83 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PUP57_RS21020 (PUP57_21020) | 4687381..4687653 | + | 273 | WP_081360544.1 | hypothetical protein | - |
| PUP57_RS21025 (PUP57_21025) | 4688286..4689077 | + | 792 | WP_081360543.1 | methyltransferase domain-containing protein | - |
| PUP57_RS21030 (PUP57_21030) | 4689393..4689875 | + | 483 | WP_009049637.1 | acyl-CoA thioesterase | - |
| PUP57_RS21035 (PUP57_21035) | 4689932..4691581 | + | 1650 | WP_081360542.1 | FMN-binding glutamate synthase family protein | - |
| PUP57_RS21040 (PUP57_21040) | 4691759..4692040 | - | 282 | WP_081360541.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PUP57_RS21045 (PUP57_21045) | 4692030..4692278 | - | 249 | WP_009044432.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| PUP57_RS21050 (PUP57_21050) | 4692375..4693163 | - | 789 | WP_081360540.1 | helix-turn-helix transcriptional regulator | - |
| PUP57_RS21055 (PUP57_21055) | 4693248..4694246 | + | 999 | WP_081360539.1 | bile acid:sodium symporter family protein | - |
| PUP57_RS21060 (PUP57_21060) | 4694460..4696223 | + | 1764 | WP_081360538.1 | hypothetical protein | - |
| PUP57_RS21065 (PUP57_21065) | 4696296..4696757 | + | 462 | WP_009049642.1 | YccF domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10821.62 Da Isoelectric Point: 10.5816
>T272804 WP_081360541.1 NZ_CP118140:c4692040-4691759 [Pseudomonas chlororaphis]
MTYELEFSEKAWKEWQKLGPTLKEQFKKKLQERLVNPHVPADRLSGLGNAYKIKLRTAGYRLVYRVVDEVLVVTVIAVGK
RERGSVYQQASKR
MTYELEFSEKAWKEWQKLGPTLKEQFKKKLQERLVNPHVPADRLSGLGNAYKIKLRTAGYRLVYRVVDEVLVVTVIAVGK
RERGSVYQQASKR
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|