Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicA-HicB |
Location | 2522043..2522662 | Replicon | chromosome |
Accession | NZ_CP118140 | ||
Organism | Pseudomonas chlororaphis strain ATCC 336632 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | - |
Locus tag | PUP57_RS11490 | Protein ID | WP_081363244.1 |
Coordinates | 2522480..2522662 (-) | Length | 61 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | A0A285IZU0 |
Locus tag | PUP57_RS11485 | Protein ID | WP_007923747.1 |
Coordinates | 2522043..2522444 (-) | Length | 134 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PUP57_RS11470 (PUP57_11470) | 2517933..2519822 | + | 1890 | WP_081362143.1 | PAS domain S-box protein | - |
PUP57_RS11475 (PUP57_11475) | 2519819..2520454 | + | 636 | WP_081362142.1 | response regulator transcription factor | - |
PUP57_RS11480 (PUP57_11480) | 2520548..2521297 | + | 750 | WP_081362141.1 | hypothetical protein | - |
PUP57_RS11485 (PUP57_11485) | 2522043..2522444 | - | 402 | WP_007923747.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
PUP57_RS11490 (PUP57_11490) | 2522480..2522662 | - | 183 | WP_081363244.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
PUP57_RS11495 (PUP57_11495) | 2522954..2523235 | - | 282 | WP_081362140.1 | hypothetical protein | - |
PUP57_RS11500 (PUP57_11500) | 2523658..2524035 | - | 378 | WP_081362139.1 | hypothetical protein | - |
PUP57_RS11505 (PUP57_11505) | 2524788..2525699 | + | 912 | WP_124344721.1 | hypothetical protein | - |
PUP57_RS11510 (PUP57_11510) | 2526021..2526497 | - | 477 | WP_081362137.1 | TIGR02391 family protein | - |
PUP57_RS11515 (PUP57_11515) | 2526481..2527191 | - | 711 | WP_124344722.1 | DUF5343 domain-containing protein | - |
PUP57_RS11520 (PUP57_11520) | 2527314..2527424 | + | 111 | Protein_2263 | serine recombinase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6759.96 Da Isoelectric Point: 10.9678
>T272802 WP_081363244.1 NZ_CP118140:c2522662-2522480 [Pseudomonas chlororaphis]
VQSRQLIKELEAAGWVLERVTGSHHLFKPPYRPETVPVPHPKKDLPRGTVRAIQKLAGLI
VQSRQLIKELEAAGWVLERVTGSHHLFKPPYRPETVPVPHPKKDLPRGTVRAIQKLAGLI
Download Length: 183 bp
Antitoxin
Download Length: 134 a.a. Molecular weight: 14579.54 Da Isoelectric Point: 4.6017
>AT272802 WP_007923747.1 NZ_CP118140:c2522444-2522043 [Pseudomonas chlororaphis]
VQYPICIEWGDEHTATGIQIPDIPGAVTAGDTFEAAYSAAIEIAHVMLEELAREGQAIPLPSPTGTHRANPDFEGMGWGM
LDIDITPYLGKTEKVNVTLPGYVIQRIDRFVREHNIKSRSSFLADAAMEKLGR
VQYPICIEWGDEHTATGIQIPDIPGAVTAGDTFEAAYSAAIEIAHVMLEELAREGQAIPLPSPTGTHRANPDFEGMGWGM
LDIDITPYLGKTEKVNVTLPGYVIQRIDRFVREHNIKSRSSFLADAAMEKLGR
Download Length: 402 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|