Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-StbC |
| Location | 561152..561822 | Replicon | chromosome |
| Accession | NZ_CP118140 | ||
| Organism | Pseudomonas chlororaphis strain ATCC 336632 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | PUP57_RS02495 | Protein ID | WP_081362979.1 |
| Coordinates | 561152..561580 (-) | Length | 143 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | A0A3G7DZE9 |
| Locus tag | PUP57_RS02500 | Protein ID | WP_009046453.1 |
| Coordinates | 561577..561822 (-) | Length | 82 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PUP57_RS02480 (PUP57_02480) | 556271..558529 | + | 2259 | WP_081362982.1 | TonB-dependent receptor | - |
| PUP57_RS02485 (PUP57_02485) | 558576..559901 | + | 1326 | WP_081362981.1 | LLM class flavin-dependent oxidoreductase | - |
| PUP57_RS02490 (PUP57_02490) | 559986..561023 | + | 1038 | WP_081362980.1 | L-glyceraldehyde 3-phosphate reductase | - |
| PUP57_RS02495 (PUP57_02495) | 561152..561580 | - | 429 | WP_081362979.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| PUP57_RS02500 (PUP57_02500) | 561577..561822 | - | 246 | WP_009046453.1 | plasmid stabilization protein | Antitoxin |
| PUP57_RS02505 (PUP57_02505) | 561962..562801 | - | 840 | WP_081362978.1 | taurine dioxygenase | - |
| PUP57_RS02510 (PUP57_02510) | 563029..563868 | - | 840 | WP_081362977.1 | taurine ABC transporter permease TauC | - |
| PUP57_RS02515 (PUP57_02515) | 563865..564659 | - | 795 | WP_081362976.1 | taurine ABC transporter ATP-binding subunit | - |
| PUP57_RS02520 (PUP57_02520) | 564755..565732 | - | 978 | WP_081362975.1 | taurine ABC transporter substrate-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 143 a.a. Molecular weight: 15853.36 Da Isoelectric Point: 5.4927
>T272801 WP_081362979.1 NZ_CP118140:c561580-561152 [Pseudomonas chlororaphis]
MIVLDTNVLSELMRPQPDTAVLLWIEAQPVEDLYISAMTMAEILHGIARLPHGKRKQTLHASAVAMFEEDFIDRIVPFGT
QAALYYAHLVSHRERSGQPINLVDAQIAAICRVHDAAIATRNTKDFTDTGLIVINPWLPLEV
MIVLDTNVLSELMRPQPDTAVLLWIEAQPVEDLYISAMTMAEILHGIARLPHGKRKQTLHASAVAMFEEDFIDRIVPFGT
QAALYYAHLVSHRERSGQPINLVDAQIAAICRVHDAAIATRNTKDFTDTGLIVINPWLPLEV
Download Length: 429 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|