Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | PumAB/COG3657-dnstrm_HI1420 |
| Location | 6663153..6663742 | Replicon | chromosome |
| Accession | NZ_CP118139 | ||
| Organism | Pseudomonas chlororaphis strain DSM 295781 | ||
Toxin (Protein)
| Gene name | PumA | Uniprot ID | - |
| Locus tag | PUP68_RS30015 | Protein ID | WP_210476686.1 |
| Coordinates | 6663443..6663742 (-) | Length | 100 a.a. |
Antitoxin (Protein)
| Gene name | PumB | Uniprot ID | - |
| Locus tag | PUP68_RS30010 | Protein ID | WP_053281098.1 |
| Coordinates | 6663153..6663446 (-) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PUP68_RS29985 (PUP68_29985) | 6658788..6659516 | + | 729 | WP_053281093.1 | ABC transporter permease | - |
| PUP68_RS29990 (PUP68_29990) | 6659513..6660223 | + | 711 | WP_053281094.1 | ABC transporter permease | - |
| PUP68_RS29995 (PUP68_29995) | 6660240..6661004 | + | 765 | WP_053281095.1 | ATP-binding cassette domain-containing protein | - |
| PUP68_RS30000 (PUP68_30000) | 6661391..6661783 | + | 393 | WP_053281096.1 | DUF3077 domain-containing protein | - |
| PUP68_RS30005 (PUP68_30005) | 6661984..6663147 | + | 1164 | WP_053281097.1 | GGDEF domain-containing protein | - |
| PUP68_RS30010 (PUP68_30010) | 6663153..6663446 | - | 294 | WP_053281098.1 | putative addiction module antidote protein | Antitoxin |
| PUP68_RS30015 (PUP68_30015) | 6663443..6663742 | - | 300 | WP_210476686.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PUP68_RS30020 (PUP68_30020) | 6663915..6664364 | + | 450 | WP_053281099.1 | DUF3828 domain-containing protein | - |
| PUP68_RS30025 (PUP68_30025) | 6664389..6665399 | - | 1011 | WP_172833187.1 | NAD(P)-dependent alcohol dehydrogenase | - |
| PUP68_RS30030 (PUP68_30030) | 6665456..6665755 | - | 300 | WP_053281101.1 | helix-turn-helix transcriptional regulator | - |
| PUP68_RS30035 (PUP68_30035) | 6665822..6666910 | - | 1089 | WP_053281102.1 | copper-containing nitrite reductase | - |
| PUP68_RS30040 (PUP68_30040) | 6667138..6667380 | + | 243 | WP_007924102.1 | exodeoxyribonuclease VII small subunit | - |
| PUP68_RS30045 (PUP68_30045) | 6667377..6668264 | + | 888 | WP_053281103.1 | (2E,6E)-farnesyl diphosphate synthase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11191.90 Da Isoelectric Point: 10.6086
>T272799 WP_210476686.1 NZ_CP118139:c6663742-6663443 [Pseudomonas chlororaphis]
MIEIKQTATFMEWENRLKDSRARALIAARIFRLANGLAGDVSPVGEGVSELRIHYGPGYRVYFQQLGSQLVILLCGGDKS
RQGRDIELAKQLARRWSRS
MIEIKQTATFMEWENRLKDSRARALIAARIFRLANGLAGDVSPVGEGVSELRIHYGPGYRVYFQQLGSQLVILLCGGDKS
RQGRDIELAKQLARRWSRS
Download Length: 300 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|