Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PumAB/upstrm_HI1419-dnstrm_HI1420 |
Location | 2661867..2662452 | Replicon | chromosome |
Accession | NZ_CP118139 | ||
Organism | Pseudomonas chlororaphis strain DSM 295781 |
Toxin (Protein)
Gene name | PumA | Uniprot ID | - |
Locus tag | PUP68_RS12315 | Protein ID | WP_210689320.1 |
Coordinates | 2662159..2662452 (-) | Length | 98 a.a. |
Antitoxin (Protein)
Gene name | PumB | Uniprot ID | - |
Locus tag | PUP68_RS12310 | Protein ID | WP_053278358.1 |
Coordinates | 2661867..2662157 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PUP68_RS12295 (PUP68_12295) | 2657192..2659672 | + | 2481 | WP_274320650.1 | FtsX-like permease family protein | - |
PUP68_RS12300 (PUP68_12300) | 2659662..2660738 | + | 1077 | WP_053278356.1 | lipocalin-like domain-containing protein | - |
PUP68_RS12305 (PUP68_12305) | 2660866..2661453 | + | 588 | WP_053278357.1 | hypothetical protein | - |
PUP68_RS12310 (PUP68_12310) | 2661867..2662157 | - | 291 | WP_053278358.1 | putative addiction module antidote protein | Antitoxin |
PUP68_RS12315 (PUP68_12315) | 2662159..2662452 | - | 294 | WP_210689320.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PUP68_RS12320 (PUP68_12320) | 2662688..2664082 | - | 1395 | WP_274320649.1 | VOC family protein | - |
PUP68_RS12325 (PUP68_12325) | 2664345..2665469 | + | 1125 | WP_053278361.1 | diguanylate cyclase | - |
PUP68_RS12330 (PUP68_12330) | 2665563..2666807 | + | 1245 | WP_274320648.1 | M20/M25/M40 family metallo-hydrolase | - |
PUP68_RS12335 (PUP68_12335) | 2667015..2667413 | + | 399 | WP_053278363.1 | carboxymuconolactone decarboxylase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 98 a.a. Molecular weight: 10768.38 Da Isoelectric Point: 10.4234
>T272797 WP_210689320.1 NZ_CP118139:c2662452-2662159 [Pseudomonas chlororaphis]
MDYEILQTTVFAQWHTRLRDLRARIAIARRIERASAGNLGDVKNLGGGLSEMRVNTGAGYRIYFTVRGNTLIVLLLGGDK
STQPADICQARSLAKEF
MDYEILQTTVFAQWHTRLRDLRARIAIARRIERASAGNLGDVKNLGGGLSEMRVNTGAGYRIYFTVRGNTLIVLLLGGDK
STQPADICQARSLAKEF
Download Length: 294 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|