Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 2647135..2647754 | Replicon | chromosome |
| Accession | NZ_CP118139 | ||
| Organism | Pseudomonas chlororaphis strain DSM 295781 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | A0A285IZB4 |
| Locus tag | PUP68_RS12245 | Protein ID | WP_009043086.1 |
| Coordinates | 2647572..2647754 (-) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | PUP68_RS12240 | Protein ID | WP_053278311.1 |
| Coordinates | 2647135..2647536 (-) | Length | 134 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PUP68_RS12225 (PUP68_12225) | 2643218..2645107 | + | 1890 | WP_274320711.1 | PAS domain S-box protein | - |
| PUP68_RS12230 (PUP68_12230) | 2645104..2645739 | + | 636 | WP_210474837.1 | response regulator transcription factor | - |
| PUP68_RS12235 (PUP68_12235) | 2645832..2646581 | + | 750 | WP_274320710.1 | hypothetical protein | - |
| PUP68_RS12240 (PUP68_12240) | 2647135..2647536 | - | 402 | WP_053278311.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| PUP68_RS12245 (PUP68_12245) | 2647572..2647754 | - | 183 | WP_009043086.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| PUP68_RS12250 (PUP68_12250) | 2648059..2648340 | - | 282 | WP_274320656.1 | hypothetical protein | - |
| PUP68_RS12255 (PUP68_12255) | 2648762..2649118 | - | 357 | WP_103330827.1 | hypothetical protein | - |
| PUP68_RS12260 (PUP68_12260) | 2649483..2649764 | - | 282 | WP_274320655.1 | hypothetical protein | - |
| PUP68_RS12265 (PUP68_12265) | 2650178..2650906 | + | 729 | WP_274320654.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 2641414..2656398 | 14984 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6800.02 Da Isoelectric Point: 11.0738
>T272796 WP_009043086.1 NZ_CP118139:c2647754-2647572 [Pseudomonas chlororaphis]
VQSRQLIKELEAAGWVLERVTGSHHLFKHPYRPETVPVPHPKKDLPRGTVRAIKKLAGLI
VQSRQLIKELEAAGWVLERVTGSHHLFKHPYRPETVPVPHPKKDLPRGTVRAIKKLAGLI
Download Length: 183 bp
Antitoxin
Download Length: 134 a.a. Molecular weight: 14591.59 Da Isoelectric Point: 4.6017
>AT272796 WP_053278311.1 NZ_CP118139:c2647536-2647135 [Pseudomonas chlororaphis]
VQYPICIEWGDEHTATGIQIPDIPGAVTAGDTFEAAYSAAIEIAHVMLEELAREGQAIPLPSPTGIHRANPDFEGMGWGM
LDIDITPYLGKTEKVNVTLPGYVIQRIDRFVREHNIKSRSSFLADAAMEKLGR
VQYPICIEWGDEHTATGIQIPDIPGAVTAGDTFEAAYSAAIEIAHVMLEELAREGQAIPLPSPTGIHRANPDFEGMGWGM
LDIDITPYLGKTEKVNVTLPGYVIQRIDRFVREHNIKSRSSFLADAAMEKLGR
Download Length: 402 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|