Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 1833521..1834143 | Replicon | chromosome |
| Accession | NZ_CP118139 | ||
| Organism | Pseudomonas chlororaphis strain DSM 295781 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | - |
| Locus tag | PUP68_RS08375 | Protein ID | WP_053277798.1 |
| Coordinates | 1833961..1834143 (-) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | PUP68_RS08370 | Protein ID | WP_053277797.1 |
| Coordinates | 1833521..1833928 (-) | Length | 136 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PUP68_RS08350 (PUP68_08350) | 1828881..1829771 | + | 891 | WP_274320933.1 | LysR family transcriptional regulator | - |
| PUP68_RS08355 (PUP68_08355) | 1830008..1831786 | + | 1779 | WP_053277794.1 | GGDEF and EAL domain-containing protein | - |
| PUP68_RS08360 (PUP68_08360) | 1831820..1832734 | - | 915 | WP_274320932.1 | SGNH/GDSL hydrolase family protein | - |
| PUP68_RS08365 (PUP68_08365) | 1832864..1833331 | - | 468 | WP_053277796.1 | GAF domain-containing protein | - |
| PUP68_RS08370 (PUP68_08370) | 1833521..1833928 | - | 408 | WP_053277797.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| PUP68_RS08375 (PUP68_08375) | 1833961..1834143 | - | 183 | WP_053277798.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| PUP68_RS08380 (PUP68_08380) | 1835209..1835925 | + | 717 | WP_053277799.1 | molecular chaperone | - |
| PUP68_RS08385 (PUP68_08385) | 1836033..1837004 | + | 972 | WP_053277800.1 | fimbrial protein | - |
| PUP68_RS08390 (PUP68_08390) | 1837173..1837777 | - | 605 | Protein_1655 | Arm DNA-binding domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6770.10 Da Isoelectric Point: 11.6709
>T272795 WP_053277798.1 NZ_CP118139:c1834143-1833961 [Pseudomonas chlororaphis]
VNSRYLIGQIVADGWYLVRVRGSHHPFRPPSKPGLVTVPHPKKDLLRKTAISILKQALLM
VNSRYLIGQIVADGWYLVRVRGSHHPFRPPSKPGLVTVPHPKKDLLRKTAISILKQALLM
Download Length: 183 bp
Antitoxin
Download Length: 136 a.a. Molecular weight: 14594.56 Da Isoelectric Point: 4.3638
>AT272795 WP_053277797.1 NZ_CP118139:c1833928-1833521 [Pseudomonas chlororaphis]
MLYPIAISMGDDEHAWGVEVPDIPGCFSAGDDLDDAMAMAREAIEGHFEILAEDGAAIPSANKVTLHAANPQYAGCTWAL
IDIDVTKYLGKAQKLNITLPGYLLNRIDEYVLHHPEAKSRSGFLASAALKVLQQD
MLYPIAISMGDDEHAWGVEVPDIPGCFSAGDDLDDAMAMAREAIEGHFEILAEDGAAIPSANKVTLHAANPQYAGCTWAL
IDIDVTKYLGKAQKLNITLPGYLLNRIDEYVLHHPEAKSRSGFLASAALKVLQQD
Download Length: 408 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|