Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 554522..555135 | Replicon | chromosome |
| Accession | NZ_CP118139 | ||
| Organism | Pseudomonas chlororaphis strain DSM 295781 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | A0A285EYZ4 |
| Locus tag | PUP68_RS02490 | Protein ID | WP_009041685.1 |
| Coordinates | 554522..554704 (+) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | PUP68_RS02495 | Protein ID | WP_274321639.1 |
| Coordinates | 554734..555135 (+) | Length | 134 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PUP68_RS02470 (PUP68_02470) | 550119..552083 | + | 1965 | WP_274321640.1 | choline transporter BetT | - |
| PUP68_RS02475 (PUP68_02475) | 552192..552449 | - | 258 | WP_210475886.1 | hypothetical protein | - |
| PUP68_RS02480 (PUP68_02480) | 552629..553369 | - | 741 | WP_053276985.1 | SDR family oxidoreductase | - |
| PUP68_RS02485 (PUP68_02485) | 553507..554397 | + | 891 | WP_053276986.1 | LysR family transcriptional regulator | - |
| PUP68_RS02490 (PUP68_02490) | 554522..554704 | + | 183 | WP_009041685.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| PUP68_RS02495 (PUP68_02495) | 554734..555135 | + | 402 | WP_274321639.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| PUP68_RS02500 (PUP68_02500) | 555158..555574 | - | 417 | WP_274321288.1 | hypothetical protein | - |
| PUP68_RS02505 (PUP68_02505) | 555723..556760 | + | 1038 | WP_053276987.1 | L-glyceraldehyde 3-phosphate reductase | - |
| PUP68_RS02510 (PUP68_02510) | 556940..557167 | - | 228 | WP_081001409.1 | hypothetical protein | - |
| PUP68_RS02515 (PUP68_02515) | 557264..558103 | - | 840 | WP_274321287.1 | taurine dioxygenase | - |
| PUP68_RS02520 (PUP68_02520) | 558188..559027 | - | 840 | WP_053276990.1 | taurine ABC transporter permease TauC | - |
| PUP68_RS02525 (PUP68_02525) | 559024..559818 | - | 795 | WP_053276991.1 | taurine ABC transporter ATP-binding subunit | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6933.08 Da Isoelectric Point: 10.4588
>T272794 WP_009041685.1 NZ_CP118139:554522-554704 [Pseudomonas chlororaphis]
MRSRELIRMIEEDGWYLIAVKGSHHQYKHLHKPGRVTIPHPDADLPRGTIHSILKQAGLK
MRSRELIRMIEEDGWYLIAVKGSHHQYKHLHKPGRVTIPHPDADLPRGTIHSILKQAGLK
Download Length: 183 bp
Antitoxin
Download Length: 134 a.a. Molecular weight: 14612.39 Da Isoelectric Point: 4.7475
>AT272794 WP_274321639.1 NZ_CP118139:554734-555135 [Pseudomonas chlororaphis]
MKFPVVLHKDADSEYGVIVPDVPGCFSAGHTAAQAFENVKEALSLHYEGLVADGEPLPQVHEVDAHIDNPDYAGGVWGVV
DFDITPYFGKAVRFNATLPEQLLERIDQTVKRDQRYRSRSGFLAAAALRELSA
MKFPVVLHKDADSEYGVIVPDVPGCFSAGHTAAQAFENVKEALSLHYEGLVADGEPLPQVHEVDAHIDNPDYAGGVWGVV
DFDITPYFGKAVRFNATLPEQLLERIDQTVKRDQRYRSRSGFLAAAALRELSA
Download Length: 402 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|