Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | PumAB/upstrm_HI1419-dnstrm_HI1420 |
| Location | 7038471..7039056 | Replicon | chromosome |
| Accession | NZ_CP118138 | ||
| Organism | Pseudomonas chlororaphis strain DSM 295782 | ||
Toxin (Protein)
| Gene name | PumA | Uniprot ID | - |
| Locus tag | PUP77_RS31840 | Protein ID | WP_210689320.1 |
| Coordinates | 7038471..7038764 (+) | Length | 98 a.a. |
Antitoxin (Protein)
| Gene name | PumB | Uniprot ID | - |
| Locus tag | PUP77_RS31845 | Protein ID | WP_053278358.1 |
| Coordinates | 7038766..7039056 (+) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PUP77_RS31820 (PUP77_31820) | 7033510..7033908 | - | 399 | WP_053278363.1 | carboxymuconolactone decarboxylase family protein | - |
| PUP77_RS31825 (PUP77_31825) | 7034116..7035360 | - | 1245 | WP_274320648.1 | M20/M25/M40 family metallo-hydrolase | - |
| PUP77_RS31830 (PUP77_31830) | 7035454..7036578 | - | 1125 | WP_053278361.1 | diguanylate cyclase | - |
| PUP77_RS31835 (PUP77_31835) | 7036841..7038235 | + | 1395 | WP_274320649.1 | VOC family protein | - |
| PUP77_RS31840 (PUP77_31840) | 7038471..7038764 | + | 294 | WP_210689320.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PUP77_RS31845 (PUP77_31845) | 7038766..7039056 | + | 291 | WP_053278358.1 | putative addiction module antidote protein | Antitoxin |
| PUP77_RS31850 (PUP77_31850) | 7039470..7040057 | - | 588 | WP_053278357.1 | hypothetical protein | - |
| PUP77_RS31855 (PUP77_31855) | 7040185..7041261 | - | 1077 | WP_053278356.1 | lipocalin-like domain-containing protein | - |
| PUP77_RS31860 (PUP77_31860) | 7041251..7043731 | - | 2481 | WP_274320650.1 | FtsX-like permease family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 98 a.a. Molecular weight: 10768.38 Da Isoelectric Point: 10.4234
>T272792 WP_210689320.1 NZ_CP118138:7038471-7038764 [Pseudomonas chlororaphis]
MDYEILQTTVFAQWHTRLRDLRARIAIARRIERASAGNLGDVKNLGGGLSEMRVNTGAGYRIYFTVRGNTLIVLLLGGDK
STQPADICQARSLAKEF
MDYEILQTTVFAQWHTRLRDLRARIAIARRIERASAGNLGDVKNLGGGLSEMRVNTGAGYRIYFTVRGNTLIVLLLGGDK
STQPADICQARSLAKEF
Download Length: 294 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|