Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | PumAB/COG3657-dnstrm_HI1420 |
| Location | 3200246..3200835 | Replicon | chromosome |
| Accession | NZ_CP118138 | ||
| Organism | Pseudomonas chlororaphis strain DSM 295782 | ||
Toxin (Protein)
| Gene name | PumA | Uniprot ID | - |
| Locus tag | PUP77_RS14845 | Protein ID | WP_210476686.1 |
| Coordinates | 3200246..3200545 (+) | Length | 100 a.a. |
Antitoxin (Protein)
| Gene name | PumB | Uniprot ID | - |
| Locus tag | PUP77_RS14850 | Protein ID | WP_053281098.1 |
| Coordinates | 3200542..3200835 (+) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PUP77_RS14815 (PUP77_14815) | 3195724..3196611 | - | 888 | WP_053281103.1 | (2E,6E)-farnesyl diphosphate synthase | - |
| PUP77_RS14820 (PUP77_14820) | 3196608..3196850 | - | 243 | WP_007924102.1 | exodeoxyribonuclease VII small subunit | - |
| PUP77_RS14825 (PUP77_14825) | 3197078..3198166 | + | 1089 | WP_053281102.1 | copper-containing nitrite reductase | - |
| PUP77_RS14830 (PUP77_14830) | 3198233..3198532 | + | 300 | WP_053281101.1 | helix-turn-helix transcriptional regulator | - |
| PUP77_RS14835 (PUP77_14835) | 3198589..3199599 | + | 1011 | WP_172833187.1 | NAD(P)-dependent alcohol dehydrogenase | - |
| PUP77_RS14840 (PUP77_14840) | 3199624..3200073 | - | 450 | WP_053281099.1 | DUF3828 domain-containing protein | - |
| PUP77_RS14845 (PUP77_14845) | 3200246..3200545 | + | 300 | WP_210476686.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PUP77_RS14850 (PUP77_14850) | 3200542..3200835 | + | 294 | WP_053281098.1 | putative addiction module antidote protein | Antitoxin |
| PUP77_RS14855 (PUP77_14855) | 3200841..3202004 | - | 1164 | WP_053281097.1 | GGDEF domain-containing protein | - |
| PUP77_RS14860 (PUP77_14860) | 3202205..3202597 | - | 393 | WP_053281096.1 | DUF3077 domain-containing protein | - |
| PUP77_RS14865 (PUP77_14865) | 3202984..3203748 | - | 765 | WP_053281095.1 | ATP-binding cassette domain-containing protein | - |
| PUP77_RS14870 (PUP77_14870) | 3203765..3204475 | - | 711 | WP_053281094.1 | ABC transporter permease | - |
| PUP77_RS14875 (PUP77_14875) | 3204472..3205200 | - | 729 | WP_053281093.1 | ABC transporter permease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11191.90 Da Isoelectric Point: 10.6086
>T272790 WP_210476686.1 NZ_CP118138:3200246-3200545 [Pseudomonas chlororaphis]
MIEIKQTATFMEWENRLKDSRARALIAARIFRLANGLAGDVSPVGEGVSELRIHYGPGYRVYFQQLGSQLVILLCGGDKS
RQGRDIELAKQLARRWSRS
MIEIKQTATFMEWENRLKDSRARALIAARIFRLANGLAGDVSPVGEGVSELRIHYGPGYRVYFQQLGSQLVILLCGGDKS
RQGRDIELAKQLARRWSRS
Download Length: 300 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|