Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 2091774..2092387 | Replicon | chromosome |
| Accession | NZ_CP118138 | ||
| Organism | Pseudomonas chlororaphis strain DSM 295782 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | A0A285EYZ4 |
| Locus tag | PUP77_RS09750 | Protein ID | WP_009041685.1 |
| Coordinates | 2092205..2092387 (-) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | PUP77_RS09745 | Protein ID | WP_274321639.1 |
| Coordinates | 2091774..2092175 (-) | Length | 134 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PUP77_RS09715 (PUP77_09715) | 2087091..2087885 | + | 795 | WP_053276991.1 | taurine ABC transporter ATP-binding subunit | - |
| PUP77_RS09720 (PUP77_09720) | 2087882..2088721 | + | 840 | WP_053276990.1 | taurine ABC transporter permease TauC | - |
| PUP77_RS09725 (PUP77_09725) | 2088806..2089645 | + | 840 | WP_274321287.1 | taurine dioxygenase | - |
| PUP77_RS09730 (PUP77_09730) | 2089742..2089969 | + | 228 | WP_081001409.1 | hypothetical protein | - |
| PUP77_RS09735 (PUP77_09735) | 2090149..2091186 | - | 1038 | WP_053276987.1 | L-glyceraldehyde 3-phosphate reductase | - |
| PUP77_RS09740 (PUP77_09740) | 2091335..2091751 | + | 417 | WP_274321288.1 | hypothetical protein | - |
| PUP77_RS09745 (PUP77_09745) | 2091774..2092175 | - | 402 | WP_274321639.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| PUP77_RS09750 (PUP77_09750) | 2092205..2092387 | - | 183 | WP_009041685.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| PUP77_RS09755 (PUP77_09755) | 2092512..2093402 | - | 891 | WP_053276986.1 | LysR family transcriptional regulator | - |
| PUP77_RS09760 (PUP77_09760) | 2093540..2094280 | + | 741 | WP_053276985.1 | SDR family oxidoreductase | - |
| PUP77_RS09765 (PUP77_09765) | 2094460..2094717 | + | 258 | WP_210475886.1 | hypothetical protein | - |
| PUP77_RS09770 (PUP77_09770) | 2094826..2096790 | - | 1965 | WP_274321640.1 | choline transporter BetT | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6933.08 Da Isoelectric Point: 10.4588
>T272789 WP_009041685.1 NZ_CP118138:c2092387-2092205 [Pseudomonas chlororaphis]
MRSRELIRMIEEDGWYLIAVKGSHHQYKHLHKPGRVTIPHPDADLPRGTIHSILKQAGLK
MRSRELIRMIEEDGWYLIAVKGSHHQYKHLHKPGRVTIPHPDADLPRGTIHSILKQAGLK
Download Length: 183 bp
Antitoxin
Download Length: 134 a.a. Molecular weight: 14612.39 Da Isoelectric Point: 4.7475
>AT272789 WP_274321639.1 NZ_CP118138:c2092175-2091774 [Pseudomonas chlororaphis]
MKFPVVLHKDADSEYGVIVPDVPGCFSAGHTAAQAFENVKEALSLHYEGLVADGEPLPQVHEVDAHIDNPDYAGGVWGVV
DFDITPYFGKAVRFNATLPEQLLERIDQTVKRDQRYRSRSGFLAAAALRELSA
MKFPVVLHKDADSEYGVIVPDVPGCFSAGHTAAQAFENVKEALSLHYEGLVADGEPLPQVHEVDAHIDNPDYAGGVWGVV
DFDITPYFGKAVRFNATLPEQLLERIDQTVKRDQRYRSRSGFLAAAALRELSA
Download Length: 402 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|