Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 812772..813394 | Replicon | chromosome |
| Accession | NZ_CP118138 | ||
| Organism | Pseudomonas chlororaphis strain DSM 295782 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | - |
| Locus tag | PUP77_RS03865 | Protein ID | WP_053277798.1 |
| Coordinates | 812772..812954 (+) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | PUP77_RS03870 | Protein ID | WP_053277797.1 |
| Coordinates | 812987..813394 (+) | Length | 136 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PUP77_RS03850 (PUP77_03850) | 809138..809742 | + | 605 | Protein_751 | Arm DNA-binding domain-containing protein | - |
| PUP77_RS03855 (PUP77_03855) | 809911..810882 | - | 972 | WP_053277800.1 | fimbrial protein | - |
| PUP77_RS03860 (PUP77_03860) | 810990..811706 | - | 717 | WP_053277799.1 | molecular chaperone | - |
| PUP77_RS03865 (PUP77_03865) | 812772..812954 | + | 183 | WP_053277798.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| PUP77_RS03870 (PUP77_03870) | 812987..813394 | + | 408 | WP_053277797.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| PUP77_RS03875 (PUP77_03875) | 813584..814051 | + | 468 | WP_053277796.1 | GAF domain-containing protein | - |
| PUP77_RS03880 (PUP77_03880) | 814181..815095 | + | 915 | WP_274320932.1 | SGNH/GDSL hydrolase family protein | - |
| PUP77_RS03885 (PUP77_03885) | 815129..816907 | - | 1779 | WP_053277794.1 | GGDEF and EAL domain-containing protein | - |
| PUP77_RS03890 (PUP77_03890) | 817144..818034 | - | 891 | WP_274320933.1 | LysR family transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6770.10 Da Isoelectric Point: 11.6709
>T272788 WP_053277798.1 NZ_CP118138:812772-812954 [Pseudomonas chlororaphis]
VNSRYLIGQIVADGWYLVRVRGSHHPFRPPSKPGLVTVPHPKKDLLRKTAISILKQALLM
VNSRYLIGQIVADGWYLVRVRGSHHPFRPPSKPGLVTVPHPKKDLLRKTAISILKQALLM
Download Length: 183 bp
Antitoxin
Download Length: 136 a.a. Molecular weight: 14594.56 Da Isoelectric Point: 4.3638
>AT272788 WP_053277797.1 NZ_CP118138:812987-813394 [Pseudomonas chlororaphis]
MLYPIAISMGDDEHAWGVEVPDIPGCFSAGDDLDDAMAMAREAIEGHFEILAEDGAAIPSANKVTLHAANPQYAGCTWAL
IDIDVTKYLGKAQKLNITLPGYLLNRIDEYVLHHPEAKSRSGFLASAALKVLQQD
MLYPIAISMGDDEHAWGVEVPDIPGCFSAGDDLDDAMAMAREAIEGHFEILAEDGAAIPSANKVTLHAANPQYAGCTWAL
IDIDVTKYLGKAQKLNITLPGYLLNRIDEYVLHHPEAKSRSGFLASAALKVLQQD
Download Length: 408 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|