Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PumAB/upstrm_HI1419-dnstrm_HI1420 |
Location | 2627191..2627776 | Replicon | chromosome |
Accession | NZ_CP118137 | ||
Organism | Pseudomonas chlororaphis strain NCCB 47033 |
Toxin (Protein)
Gene name | PumA | Uniprot ID | A0A3G7C0N8 |
Locus tag | PUP65_RS11940 | Protein ID | WP_025804099.1 |
Coordinates | 2627483..2627776 (-) | Length | 98 a.a. |
Antitoxin (Protein)
Gene name | PumB | Uniprot ID | A0A3G7CJP2 |
Locus tag | PUP65_RS11935 | Protein ID | WP_025804100.1 |
Coordinates | 2627191..2627481 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PUP65_RS11920 (PUP65_11920) | 2622516..2624996 | + | 2481 | WP_124325843.1 | FtsX-like permease family protein | - |
PUP65_RS11925 (PUP65_11925) | 2624986..2626062 | + | 1077 | WP_124323951.1 | lipocalin-like domain-containing protein | - |
PUP65_RS11930 (PUP65_11930) | 2626190..2626777 | + | 588 | WP_063429489.1 | hypothetical protein | - |
PUP65_RS11935 (PUP65_11935) | 2627191..2627481 | - | 291 | WP_025804100.1 | putative addiction module antidote protein | Antitoxin |
PUP65_RS11940 (PUP65_11940) | 2627483..2627776 | - | 294 | WP_025804099.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PUP65_RS11945 (PUP65_11945) | 2628012..2629406 | - | 1395 | WP_124323952.1 | VOC family protein | - |
PUP65_RS11950 (PUP65_11950) | 2629669..2630793 | + | 1125 | WP_124323953.1 | diguanylate cyclase | - |
PUP65_RS11955 (PUP65_11955) | 2630887..2632131 | + | 1245 | WP_124323954.1 | M20/M25/M40 family metallo-hydrolase | - |
PUP65_RS11960 (PUP65_11960) | 2632344..2632742 | + | 399 | WP_016702749.1 | carboxymuconolactone decarboxylase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 98 a.a. Molecular weight: 10837.49 Da Isoelectric Point: 10.7289
>T272786 WP_025804099.1 NZ_CP118137:c2627776-2627483 [Pseudomonas chlororaphis]
MEYEILQTTVFAQWHTRLRDLRARIAIARRIERASAGNLGDVKNLGGGLSEMRVNRGAGYRIYFTVRGNTLIVLLLGGDK
STQPADICQARSLAKEF
MEYEILQTTVFAQWHTRLRDLRARIAIARRIERASAGNLGDVKNLGGGLSEMRVNRGAGYRIYFTVRGNTLIVLLLGGDK
STQPADICQARSLAKEF
Download Length: 294 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3G7C0N8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3G7CJP2 |