Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 1782447..1783069 | Replicon | chromosome |
| Accession | NZ_CP118137 | ||
| Organism | Pseudomonas chlororaphis strain NCCB 47033 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | - |
| Locus tag | PUP65_RS08125 | Protein ID | WP_106696706.1 |
| Coordinates | 1782887..1783069 (-) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | PUP65_RS08120 | Protein ID | WP_106698998.1 |
| Coordinates | 1782447..1782854 (-) | Length | 136 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PUP65_RS08100 (PUP65_08100) | 1777749..1778642 | + | 894 | WP_173678573.1 | LysR family transcriptional regulator | - |
| PUP65_RS08105 (PUP65_08105) | 1778878..1780656 | + | 1779 | WP_124323664.1 | GGDEF and EAL domain-containing protein | - |
| PUP65_RS08110 (PUP65_08110) | 1780690..1781604 | - | 915 | WP_124323665.1 | SGNH/GDSL hydrolase family protein | - |
| PUP65_RS08115 (PUP65_08115) | 1781734..1782201 | - | 468 | WP_106696705.1 | GAF domain-containing protein | - |
| PUP65_RS08120 (PUP65_08120) | 1782447..1782854 | - | 408 | WP_106698998.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| PUP65_RS08125 (PUP65_08125) | 1782887..1783069 | - | 183 | WP_106696706.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| PUP65_RS08135 (PUP65_08135) | 1783788..1784672 | - | 885 | WP_009047472.1 | alpha/beta hydrolase | - |
| PUP65_RS08140 (PUP65_08140) | 1785024..1785716 | - | 693 | WP_025804997.1 | 16S rRNA pseudouridine(516) synthase | - |
| PUP65_RS08145 (PUP65_08145) | 1785750..1785968 | - | 219 | WP_274346761.1 | cysteine-rich CWC family protein | - |
| PUP65_RS08150 (PUP65_08150) | 1785976..1787463 | - | 1488 | WP_106696708.1 | sensor domain-containing diguanylate cyclase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6810.12 Da Isoelectric Point: 11.6709
>T272784 WP_106696706.1 NZ_CP118137:c1783069-1782887 [Pseudomonas chlororaphis]
VNSRYLIGQIVADGWYLVRVRGSHHPFRHPSKPGLVTVPHPKKDLLRKTAISILKQALLM
VNSRYLIGQIVADGWYLVRVRGSHHPFRHPSKPGLVTVPHPKKDLLRKTAISILKQALLM
Download Length: 183 bp
Antitoxin
Download Length: 136 a.a. Molecular weight: 14657.65 Da Isoelectric Point: 4.4710
>AT272784 WP_106698998.1 NZ_CP118137:c1782854-1782447 [Pseudomonas chlororaphis]
MLYPIAISMGDDEHAWGVEVPDIPGCFSAGDDLDDAMAMAREAIEGHFEILAEDGAAIPPANKVTLHAANPQYAGRTWAL
IDIDVTKYLGKAQKLNITLPGYLLNRIDEYVLHHPEAKSRSGFLASAALKVLQQD
MLYPIAISMGDDEHAWGVEVPDIPGCFSAGDDLDDAMAMAREAIEGHFEILAEDGAAIPPANKVTLHAANPQYAGRTWAL
IDIDVTKYLGKAQKLNITLPGYLLNRIDEYVLHHPEAKSRSGFLASAALKVLQQD
Download Length: 408 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|