Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-StbC |
| Location | 545294..545964 | Replicon | chromosome |
| Accession | NZ_CP118137 | ||
| Organism | Pseudomonas chlororaphis strain NCCB 47033 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | PUP65_RS02435 | Protein ID | WP_124323278.1 |
| Coordinates | 545294..545722 (-) | Length | 143 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | A0A3G7DZE9 |
| Locus tag | PUP65_RS02440 | Protein ID | WP_009046453.1 |
| Coordinates | 545719..545964 (-) | Length | 82 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PUP65_RS02405 (PUP65_02405) | 540493..540981 | - | 489 | WP_124323274.1 | DoxX family membrane protein | - |
| PUP65_RS02410 (PUP65_02410) | 541038..541778 | - | 741 | WP_124323275.1 | SDR family oxidoreductase | - |
| PUP65_RS02415 (PUP65_02415) | 541908..542798 | + | 891 | WP_124323276.1 | LysR family transcriptional regulator | - |
| PUP65_RS02420 (PUP65_02420) | 542923..543105 | + | 183 | WP_009041685.1 | type II toxin-antitoxin system HicA family toxin | - |
| PUP65_RS02425 (PUP65_02425) | 543135..543536 | + | 402 | WP_025808441.1 | type II toxin-antitoxin system HicB family antitoxin | - |
| PUP65_RS02430 (PUP65_02430) | 544127..545164 | + | 1038 | WP_124323277.1 | L-glyceraldehyde 3-phosphate reductase | - |
| PUP65_RS02435 (PUP65_02435) | 545294..545722 | - | 429 | WP_124323278.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| PUP65_RS02440 (PUP65_02440) | 545719..545964 | - | 246 | WP_009046453.1 | plasmid stabilization protein | Antitoxin |
| PUP65_RS02445 (PUP65_02445) | 546104..546943 | - | 840 | WP_124323279.1 | taurine dioxygenase | - |
| PUP65_RS02450 (PUP65_02450) | 547181..548020 | - | 840 | WP_124323280.1 | taurine ABC transporter permease TauC | - |
| PUP65_RS02455 (PUP65_02455) | 548017..548811 | - | 795 | WP_023970012.1 | taurine ABC transporter ATP-binding subunit | - |
| PUP65_RS02460 (PUP65_02460) | 548922..549899 | - | 978 | WP_124323281.1 | taurine ABC transporter substrate-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 143 a.a. Molecular weight: 15862.37 Da Isoelectric Point: 5.4577
>T272782 WP_124323278.1 NZ_CP118137:c545722-545294 [Pseudomonas chlororaphis]
MIVLDTNVLSELMHPQPDTAVLLWIEAQPVEDLYISAMTMAEILHGIARLPHGKRKQTLHASALAMFEEDFIDRIVPFGT
QAALYYAHLVSHRERSGQPINLVDAQIAAICRVHDAAIATRNTKDFTDTGLIVINPWLPLEI
MIVLDTNVLSELMHPQPDTAVLLWIEAQPVEDLYISAMTMAEILHGIARLPHGKRKQTLHASALAMFEEDFIDRIVPFGT
QAALYYAHLVSHRERSGQPINLVDAQIAAICRVHDAAIATRNTKDFTDTGLIVINPWLPLEI
Download Length: 429 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|