Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicA-HicB |
Location | 3003347..3003951 | Replicon | chromosome |
Accession | NZ_CP118136 | ||
Organism | Pseudomonas chlororaphis strain NCCB 60038 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | - |
Locus tag | PUP52_RS13780 | Protein ID | WP_041988418.1 |
Coordinates | 3003784..3003951 (-) | Length | 56 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | A0A554PQR3 |
Locus tag | PUP52_RS13775 | Protein ID | WP_041988420.1 |
Coordinates | 3003347..3003748 (-) | Length | 134 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PUP52_RS13760 (PUP52_13760) | 2998585..2999511 | + | 927 | WP_041986432.1 | 2-dehydropantoate 2-reductase | - |
PUP52_RS13765 (PUP52_13765) | 2999671..3001146 | + | 1476 | WP_041986430.1 | aldehyde dehydrogenase family protein | - |
PUP52_RS13770 (PUP52_13770) | 3001273..3002526 | + | 1254 | WP_041986428.1 | OprD family porin | - |
PUP52_RS13775 (PUP52_13775) | 3003347..3003748 | - | 402 | WP_041988420.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
PUP52_RS13780 (PUP52_13780) | 3003784..3003951 | - | 168 | WP_041988418.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
PUP52_RS13785 (PUP52_13785) | 3004331..3004612 | - | 282 | WP_041988415.1 | hypothetical protein | - |
PUP52_RS13790 (PUP52_13790) | 3005305..3006630 | + | 1326 | WP_041988412.1 | hypothetical protein | - |
PUP52_RS13795 (PUP52_13795) | 3006778..3007158 | - | 381 | WP_124355740.1 | hypothetical protein | - |
PUP52_RS13800 (PUP52_13800) | 3008019..3008567 | - | 549 | WP_041988409.1 | YniB family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 56 a.a. Molecular weight: 6219.35 Da Isoelectric Point: 10.6778
>T272777 WP_041988418.1 NZ_CP118136:c3003951-3003784 [Pseudomonas chlororaphis]
MIKELEAAGWVLERVTGSHHLFKHPYRPETVPVPHPKKDLPRGTVRAIQKLAGLI
MIKELEAAGWVLERVTGSHHLFKHPYRPETVPVPHPKKDLPRGTVRAIQKLAGLI
Download Length: 168 bp
Antitoxin
Download Length: 134 a.a. Molecular weight: 14609.56 Da Isoelectric Point: 4.6017
>AT272777 WP_041988420.1 NZ_CP118136:c3003748-3003347 [Pseudomonas chlororaphis]
VQYPICIEWGDEHTATGIQIPDIPGAVTAGDTFEAAYSAAIEIAHVMLEELAREGQTIPLPSPTGTHRANPDFEGMGWGM
LDIDITPYLGKTEKVNVTLPGYVIQRIDRFVREHNIKSRSSFLADAAMEKLGR
VQYPICIEWGDEHTATGIQIPDIPGAVTAGDTFEAAYSAAIEIAHVMLEELAREGQTIPLPSPTGTHRANPDFEGMGWGM
LDIDITPYLGKTEKVNVTLPGYVIQRIDRFVREHNIKSRSSFLADAAMEKLGR
Download Length: 402 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|