Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 544155..544768 Replicon chromosome
Accession NZ_CP118136
Organism Pseudomonas chlororaphis strain NCCB 60038

Toxin (Protein)


Gene name hicA Uniprot ID A0A285EYZ4
Locus tag PUP52_RS02430 Protein ID WP_009041685.1
Coordinates 544155..544337 (+) Length 61 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID A0A554PT90
Locus tag PUP52_RS02435 Protein ID WP_009046450.1
Coordinates 544367..544768 (+) Length 134 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PUP52_RS02400 (PUP52_02400) 539930..540187 - 258 WP_009046444.1 hypothetical protein -
PUP52_RS02405 (PUP52_02405) 540240..540728 - 489 WP_041985368.1 DoxX family protein -
PUP52_RS02410 (PUP52_02410) 540802..541698 - 897 WP_041985371.1 SDR family oxidoreductase -
PUP52_RS02415 (PUP52_02415) 541727..542236 - 510 WP_009046447.1 DUF1097 domain-containing protein -
PUP52_RS02420 (PUP52_02420) 542270..543010 - 741 WP_016702555.1 SDR family oxidoreductase -
PUP52_RS02425 (PUP52_02425) 543140..544030 + 891 WP_041985374.1 LysR family transcriptional regulator -
PUP52_RS02430 (PUP52_02430) 544155..544337 + 183 WP_009041685.1 type II toxin-antitoxin system HicA family toxin Toxin
PUP52_RS02435 (PUP52_02435) 544367..544768 + 402 WP_009046450.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
PUP52_RS02440 (PUP52_02440) 545338..546375 + 1038 WP_016702559.1 L-glyceraldehyde 3-phosphate reductase -
PUP52_RS02445 (PUP52_02445) 546505..546933 - 429 WP_041985377.1 type II toxin-antitoxin system VapC family toxin -
PUP52_RS02450 (PUP52_02450) 546930..547175 - 246 WP_009046453.1 plasmid stabilization protein -
PUP52_RS02455 (PUP52_02455) 547315..548154 - 840 WP_009046454.1 taurine dioxygenase -
PUP52_RS02460 (PUP52_02460) 548390..549229 - 840 WP_009046455.1 taurine ABC transporter permease TauC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(3-59)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(3-127)


Sequences

Toxin        


Download         Length: 61 a.a.        Molecular weight: 6933.08 Da        Isoelectric Point: 10.4588

>T272775 WP_009041685.1 NZ_CP118136:544155-544337 [Pseudomonas chlororaphis]
MRSRELIRMIEEDGWYLIAVKGSHHQYKHLHKPGRVTIPHPDADLPRGTIHSILKQAGLK

Download         Length: 183 bp

Antitoxin


Download         Length: 134 a.a.        Molecular weight: 14596.44 Da        Isoelectric Point: 4.9133

>AT272775 WP_009046450.1 NZ_CP118136:544367-544768 [Pseudomonas chlororaphis]
MKFPVVLHKDADSGYGVIVPDVPGCFSAGHTAAQAFENVKEALSLHYEGLVADGEPLPQVHEVDVHIDNPDYAGGVWGVI
EFDITPYFGKAVRFNATLPEQLLERIDQTVKRDQRYRSRSGFLAAAALRELSA

Download         Length: 402 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A285EYZ4

Antitoxin

Source ID Structure
AlphaFold DB A0A554PT90

References