Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | stbE-relB/ParE-YafN |
| Location | 433022..433538 | Replicon | chromosome |
| Accession | NZ_CP118136 | ||
| Organism | Pseudomonas chlororaphis strain NCCB 60038 | ||
Toxin (Protein)
| Gene name | stbE | Uniprot ID | A0A285EY61 |
| Locus tag | PUP52_RS01915 | Protein ID | WP_009041601.1 |
| Coordinates | 433257..433538 (+) | Length | 94 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | A0A554PKE4 |
| Locus tag | PUP52_RS01910 | Protein ID | WP_009046356.1 |
| Coordinates | 433022..433267 (+) | Length | 82 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PUP52_RS01885 (PUP52_01885) | 428790..429785 | + | 996 | WP_041985268.1 | aspartyl beta-hydroxylase | - |
| PUP52_RS01890 (PUP52_01890) | 429751..430509 | - | 759 | WP_009046352.1 | slipin family protein | - |
| PUP52_RS01895 (PUP52_01895) | 430511..431896 | - | 1386 | WP_009046353.1 | nodulation protein NfeD | - |
| PUP52_RS01900 (PUP52_01900) | 432120..432581 | + | 462 | WP_016705004.1 | YbaK/EbsC family protein | - |
| PUP52_RS01905 (PUP52_01905) | 432712..432957 | + | 246 | WP_009046355.1 | DUF2789 domain-containing protein | - |
| PUP52_RS01910 (PUP52_01910) | 433022..433267 | + | 246 | WP_009046356.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| PUP52_RS01915 (PUP52_01915) | 433257..433538 | + | 282 | WP_009041601.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PUP52_RS01920 (PUP52_01920) | 433671..434099 | + | 429 | WP_009046358.1 | MarR family transcriptional regulator | - |
| PUP52_RS01925 (PUP52_01925) | 434096..436180 | + | 2085 | WP_041985273.1 | FUSC family protein | - |
| PUP52_RS01930 (PUP52_01930) | 436177..436386 | + | 210 | WP_041985274.1 | DUF1656 domain-containing protein | - |
| PUP52_RS01935 (PUP52_01935) | 436383..437276 | + | 894 | WP_041985277.1 | HlyD family secretion protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10879.81 Da Isoelectric Point: 10.5797
>T272774 WP_009041601.1 NZ_CP118136:433257-433538 [Pseudomonas chlororaphis]
MTYKLQFLPSARKEWDKLGHTLREQFKKKLAERLEMPRVPADALHGMADCYKIKLKASGYRLVYQVIEDQVVVSVVAVGK
RERSAVYERARKR
MTYKLQFLPSARKEWDKLGHTLREQFKKKLAERLEMPRVPADALHGMADCYKIKLKASGYRLVYQVIEDQVVVSVVAVGK
RERSAVYERARKR
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A285EY61 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A554PKE4 |