Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PumAB/upstrm_HI1419-dnstrm_HI1420 |
Location | 6467701..6468286 | Replicon | chromosome |
Accession | NZ_CP118135 | ||
Organism | Pseudomonas chlororaphis strain NCCB 820532 |
Toxin (Protein)
Gene name | PumA | Uniprot ID | - |
Locus tag | PUP76_RS29425 | Protein ID | WP_274301021.1 |
Coordinates | 6467993..6468286 (-) | Length | 98 a.a. |
Antitoxin (Protein)
Gene name | PumB | Uniprot ID | A0A3G7H967 |
Locus tag | PUP76_RS29420 | Protein ID | WP_062822914.1 |
Coordinates | 6467701..6467991 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PUP76_RS29410 (PUP76_29410) | 6465216..6466598 | + | 1383 | WP_062822916.1 | efflux transporter outer membrane subunit | - |
PUP76_RS29415 (PUP76_29415) | 6466717..6467304 | + | 588 | WP_007923530.1 | hypothetical protein | - |
PUP76_RS29420 (PUP76_29420) | 6467701..6467991 | - | 291 | WP_062822914.1 | putative addiction module antidote protein | Antitoxin |
PUP76_RS29425 (PUP76_29425) | 6467993..6468286 | - | 294 | WP_274301021.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PUP76_RS29430 (PUP76_29430) | 6468522..6469916 | - | 1395 | WP_274301022.1 | VOC family protein | - |
PUP76_RS29435 (PUP76_29435) | 6470181..6471305 | + | 1125 | WP_274301023.1 | diguanylate cyclase | - |
PUP76_RS29440 (PUP76_29440) | 6471399..6472643 | + | 1245 | WP_274301024.1 | M20/M25/M40 family metallo-hydrolase | - |
PUP76_RS29445 (PUP76_29445) | 6472875..6473270 | + | 396 | WP_062822909.1 | carboxymuconolactone decarboxylase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 98 a.a. Molecular weight: 10764.40 Da Isoelectric Point: 10.4234
>T272773 WP_274301021.1 NZ_CP118135:c6468286-6467993 [Pseudomonas chlororaphis]
MDYEILQTTVFARWHTTLRDLRARIAIARRIERASAGNLGDVKNLGGGLSEMRVNTGAGYRLYFTVRGHTLIVLLLGGDK
STQPADICQARSLAKEF
MDYEILQTTVFARWHTTLRDLRARIAIARRIERASAGNLGDVKNLGGGLSEMRVNTGAGYRLYFTVRGHTLIVLLLGGDK
STQPADICQARSLAKEF
Download Length: 294 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|