Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | relBE/ParE-YafN |
Location | 5051929..5052448 | Replicon | chromosome |
Accession | NZ_CP118135 | ||
Organism | Pseudomonas chlororaphis strain NCCB 820532 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A1H3UB31 |
Locus tag | PUP76_RS23205 | Protein ID | WP_007930524.1 |
Coordinates | 5052167..5052448 (+) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A1H3UB71 |
Locus tag | PUP76_RS23200 | Protein ID | WP_009044432.1 |
Coordinates | 5051929..5052177 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PUP76_RS23180 (PUP76_23180) | 5047337..5047798 | - | 462 | WP_274300393.1 | YccF domain-containing protein | - |
PUP76_RS23185 (PUP76_23185) | 5047871..5049637 | - | 1767 | WP_274300394.1 | hypothetical protein | - |
PUP76_RS23190 (PUP76_23190) | 5049961..5050959 | - | 999 | WP_114760888.1 | bile acid:sodium symporter family protein | - |
PUP76_RS23195 (PUP76_23195) | 5051044..5051832 | + | 789 | WP_085534323.1 | helix-turn-helix transcriptional regulator | - |
PUP76_RS23200 (PUP76_23200) | 5051929..5052177 | + | 249 | WP_009044432.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
PUP76_RS23205 (PUP76_23205) | 5052167..5052448 | + | 282 | WP_007930524.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PUP76_RS23210 (PUP76_23210) | 5052640..5054289 | - | 1650 | WP_274300395.1 | FMN-binding glutamate synthase family protein | - |
PUP76_RS23215 (PUP76_23215) | 5054342..5054824 | - | 483 | WP_009044429.1 | acyl-CoA thioesterase | - |
PUP76_RS23220 (PUP76_23220) | 5055963..5056235 | - | 273 | WP_007927368.1 | hypothetical protein | - |
PUP76_RS23225 (PUP76_23225) | 5056546..5057127 | + | 582 | WP_253364919.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10890.73 Da Isoelectric Point: 10.6993
>T272771 WP_007930524.1 NZ_CP118135:5052167-5052448 [Pseudomonas chlororaphis]
MTYELEFSEKAWKEWQKLGPTLKEQFKKKLQERLVNPHVPADRLSGLGNAYKIKLRTAGYRLVYRVVDEVLVVTVIAVGK
RERGSVYQQARKR
MTYELEFSEKAWKEWQKLGPTLKEQFKKKLQERLVNPHVPADRLSGLGNAYKIKLRTAGYRLVYRVVDEVLVVTVIAVGK
RERGSVYQQARKR
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1H3UB31 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1H3UB71 |