Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | stbE-relB/ParE-YafN |
Location | 2090872..2091388 | Replicon | chromosome |
Accession | NZ_CP118135 | ||
Organism | Pseudomonas chlororaphis strain NCCB 820532 |
Toxin (Protein)
Gene name | stbE | Uniprot ID | A0A285EY61 |
Locus tag | PUP76_RS09595 | Protein ID | WP_009041601.1 |
Coordinates | 2090872..2091153 (-) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A285F0M2 |
Locus tag | PUP76_RS09600 | Protein ID | WP_062824057.1 |
Coordinates | 2091143..2091388 (-) | Length | 82 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PUP76_RS09575 (PUP76_09575) | 2087132..2088028 | - | 897 | WP_274301765.1 | HlyD family secretion protein | - |
PUP76_RS09580 (PUP76_09580) | 2088025..2088234 | - | 210 | WP_007932080.1 | DUF1656 domain-containing protein | - |
PUP76_RS09585 (PUP76_09585) | 2088231..2090315 | - | 2085 | WP_087092318.1 | FUSC family protein | - |
PUP76_RS09590 (PUP76_09590) | 2090312..2090740 | - | 429 | WP_085533251.1 | MarR family transcriptional regulator | - |
PUP76_RS09595 (PUP76_09595) | 2090872..2091153 | - | 282 | WP_009041601.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PUP76_RS09600 (PUP76_09600) | 2091143..2091388 | - | 246 | WP_062824057.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
PUP76_RS09605 (PUP76_09605) | 2091451..2091696 | - | 246 | WP_009041599.1 | DUF2789 domain-containing protein | - |
PUP76_RS09610 (PUP76_09610) | 2091834..2092295 | - | 462 | WP_062824058.1 | YbaK/EbsC family protein | - |
PUP76_RS09615 (PUP76_09615) | 2092519..2093904 | + | 1386 | WP_274301766.1 | nodulation protein NfeD | - |
PUP76_RS09620 (PUP76_09620) | 2093906..2094664 | + | 759 | WP_097134106.1 | slipin family protein | - |
PUP76_RS09625 (PUP76_09625) | 2094630..2095625 | - | 996 | WP_274301767.1 | sulfotransferase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10879.81 Da Isoelectric Point: 10.5797
>T272769 WP_009041601.1 NZ_CP118135:c2091153-2090872 [Pseudomonas chlororaphis]
MTYKLQFLPSARKEWDKLGHTLREQFKKKLAERLEMPRVPADALHGMADCYKIKLKASGYRLVYQVIEDQVVVSVVAVGK
RERSAVYERARKR
MTYKLQFLPSARKEWDKLGHTLREQFKKKLAERLEMPRVPADALHGMADCYKIKLKASGYRLVYQVIEDQVVVSVVAVGK
RERSAVYERARKR
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A285EY61 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A285F0M2 |