Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-StbC |
Location | 1974054..1974724 | Replicon | chromosome |
Accession | NZ_CP118135 | ||
Organism | Pseudomonas chlororaphis strain NCCB 820532 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | PUP76_RS09065 | Protein ID | WP_123411912.1 |
Coordinates | 1974296..1974724 (+) | Length | 143 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | A0A2N8BIH3 |
Locus tag | PUP76_RS09060 | Protein ID | WP_062823999.1 |
Coordinates | 1974054..1974299 (+) | Length | 82 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PUP76_RS09040 (PUP76_09040) | 1970300..1971277 | + | 978 | WP_009041696.1 | taurine ABC transporter substrate-binding protein | - |
PUP76_RS09045 (PUP76_09045) | 1971372..1972166 | + | 795 | WP_085533376.1 | taurine ABC transporter ATP-binding subunit | - |
PUP76_RS09050 (PUP76_09050) | 1972163..1973002 | + | 840 | WP_009041694.1 | taurine ABC transporter permease TauC | - |
PUP76_RS09055 (PUP76_09055) | 1973087..1973926 | + | 840 | WP_274301720.1 | taurine dioxygenase | - |
PUP76_RS09060 (PUP76_09060) | 1974054..1974299 | + | 246 | WP_062823999.1 | hypothetical protein | Antitoxin |
PUP76_RS09065 (PUP76_09065) | 1974296..1974724 | + | 429 | WP_123411912.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
PUP76_RS09070 (PUP76_09070) | 1974850..1975887 | - | 1038 | WP_053259262.1 | L-glyceraldehyde 3-phosphate reductase | - |
PUP76_RS09075 (PUP76_09075) | 1975972..1977297 | - | 1326 | WP_009041689.1 | LLM class flavin-dependent oxidoreductase | - |
PUP76_RS09080 (PUP76_09080) | 1977344..1979602 | - | 2259 | WP_274301721.1 | TonB-dependent receptor | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 143 a.a. Molecular weight: 15853.46 Da Isoelectric Point: 5.4985
>T272767 WP_123411912.1 NZ_CP118135:1974296-1974724 [Pseudomonas chlororaphis]
MIVLDTNVLSELMRPQPDASVLLWIEAQPVEDLYISAMTMAEILHGIARLPHGRRKQMLHASALAMFEEDFIERIVPFGT
QAALYYAHLISHRESLGRPISLVDAQIAAICRVHDAAIATRNAKDFSDTGLIVINPWLPLEV
MIVLDTNVLSELMRPQPDASVLLWIEAQPVEDLYISAMTMAEILHGIARLPHGRRKQMLHASALAMFEEDFIERIVPFGT
QAALYYAHLISHRESLGRPISLVDAQIAAICRVHDAAIATRNAKDFSDTGLIVINPWLPLEV
Download Length: 429 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|