Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RHH(antitoxin) |
Location | 1292856..1293394 | Replicon | chromosome |
Accession | NZ_CP118135 | ||
Organism | Pseudomonas chlororaphis strain NCCB 820532 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A285H8D2 |
Locus tag | PUP76_RS06085 | Protein ID | WP_009042149.1 |
Coordinates | 1292856..1293134 (-) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | PUP76_RS06090 | Protein ID | WP_009042148.1 |
Coordinates | 1293131..1293394 (-) | Length | 88 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PUP76_RS06065 (PUP76_06065) | 1288350..1289243 | + | 894 | WP_274301533.1 | glycine betaine ABC transporter substrate-binding protein | - |
PUP76_RS06070 (PUP76_06070) | 1289258..1289911 | + | 654 | WP_053259627.1 | ABC transporter permease | - |
PUP76_RS06075 (PUP76_06075) | 1289908..1291065 | + | 1158 | WP_274301534.1 | ABC transporter ATP-binding protein | - |
PUP76_RS06080 (PUP76_06080) | 1291618..1292781 | + | 1164 | WP_009042150.1 | type III PLP-dependent enzyme | - |
PUP76_RS06085 (PUP76_06085) | 1292856..1293134 | - | 279 | WP_009042149.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PUP76_RS06090 (PUP76_06090) | 1293131..1293394 | - | 264 | WP_009042148.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
PUP76_RS06095 (PUP76_06095) | 1293455..1294240 | - | 786 | WP_274301535.1 | tetratricopeptide repeat protein | - |
PUP76_RS06100 (PUP76_06100) | 1294244..1294924 | - | 681 | WP_085529819.1 | Fe2+-dependent dioxygenase | - |
PUP76_RS06105 (PUP76_06105) | 1295130..1297403 | + | 2274 | WP_085529818.1 | TonB-dependent siderophore receptor | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10853.45 Da Isoelectric Point: 8.5409
>T272765 WP_009042149.1 NZ_CP118135:c1293134-1292856 [Pseudomonas chlororaphis]
VRELKWTSKALSDLARLFEFLAPVNRSVAARTVQSLTQAPDTLLTNPRIGEQLEEFQPRDVRRLLVGPYEMRYEIQDATL
YILRVWHVREDR
VRELKWTSKALSDLARLFEFLAPVNRSVAARTVQSLTQAPDTLLTNPRIGEQLEEFQPRDVRRLLVGPYEMRYEIQDATL
YILRVWHVREDR
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|