Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 1330291..1330926 | Replicon | chromosome |
Accession | NZ_CP118108 | ||
Organism | Paenibacillus urinalis strain 2022CK-00829 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | PUW25_RS05900 | Protein ID | WP_047912142.1 |
Coordinates | 1330576..1330926 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | - |
Locus tag | PUW25_RS05895 | Protein ID | WP_047912143.1 |
Coordinates | 1330291..1330572 (+) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PUW25_RS05880 (PUW25_05880) | 1326536..1327099 | + | 564 | WP_047912146.1 | transcriptional regulator | - |
PUW25_RS05885 (PUW25_05885) | 1327290..1328528 | + | 1239 | WP_047912145.1 | DUF4367 domain-containing protein | - |
PUW25_RS05890 (PUW25_05890) | 1328867..1330063 | + | 1197 | WP_047912144.1 | alanine racemase | - |
PUW25_RS05895 (PUW25_05895) | 1330291..1330572 | + | 282 | WP_047912143.1 | ribbon-helix-helix protein, CopG family | Antitoxin |
PUW25_RS05900 (PUW25_05900) | 1330576..1330926 | + | 351 | WP_047912142.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
PUW25_RS05905 (PUW25_05905) | 1331186..1333375 | + | 2190 | WP_047912304.1 | alpha-galactosidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12779.76 Da Isoelectric Point: 4.8384
>T272759 WP_047912142.1 NZ_CP118108:1330576-1330926 [Paenibacillus urinalis]
MIVKRGDVFFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTCIVAAITAQIQKAKLPTHVEIDAELHGFDRDSVVLLEQI
RTIDKQRLTDKITHLDDDTMKLVGEALQISLGLIDF
MIVKRGDVFFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTCIVAAITAQIQKAKLPTHVEIDAELHGFDRDSVVLLEQI
RTIDKQRLTDKITHLDDDTMKLVGEALQISLGLIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|