Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 1458062..1458697 | Replicon | chromosome |
Accession | NZ_CP118101 | ||
Organism | Paenibacillus urinalis strain 2022CK-00830 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | PUW23_RS06370 | Protein ID | WP_047912142.1 |
Coordinates | 1458347..1458697 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | - |
Locus tag | PUW23_RS06365 | Protein ID | WP_047912143.1 |
Coordinates | 1458062..1458343 (+) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PUW23_RS06350 (PUW23_06350) | 1454311..1454874 | + | 564 | WP_205053870.1 | GbsR/MarR family transcriptional regulator | - |
PUW23_RS06355 (PUW23_06355) | 1455061..1456299 | + | 1239 | WP_205053869.1 | outer membrane lipoprotein-sorting protein | - |
PUW23_RS06360 (PUW23_06360) | 1456638..1457834 | + | 1197 | WP_205053868.1 | alanine racemase | - |
PUW23_RS06365 (PUW23_06365) | 1458062..1458343 | + | 282 | WP_047912143.1 | ribbon-helix-helix protein, CopG family | Antitoxin |
PUW23_RS06370 (PUW23_06370) | 1458347..1458697 | + | 351 | WP_047912142.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
PUW23_RS06375 (PUW23_06375) | 1459299..1460591 | + | 1293 | WP_274338793.1 | group II intron reverse transcriptase/maturase | - |
PUW23_RS06380 (PUW23_06380) | 1460891..1463080 | + | 2190 | WP_205053864.1 | alpha-galactosidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12779.76 Da Isoelectric Point: 4.8384
>T272757 WP_047912142.1 NZ_CP118101:1458347-1458697 [Paenibacillus urinalis]
MIVKRGDVFFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTCIVAAITAQIQKAKLPTHVEIDAELHGFDRDSVVLLEQI
RTIDKQRLTDKITHLDDDTMKLVGEALQISLGLIDF
MIVKRGDVFFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTCIVAAITAQIQKAKLPTHVEIDAELHGFDRDSVVLLEQI
RTIDKQRLTDKITHLDDDTMKLVGEALQISLGLIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|