Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relE-dinJ/YafQ-DinJ |
Location | 1192473..1192998 | Replicon | chromosome |
Accession | NZ_CP118095 | ||
Organism | Aerococcus christensenii strain VSI03 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | PUW42_RS05665 | Protein ID | WP_274980588.1 |
Coordinates | 1192720..1192998 (+) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | dinJ | Uniprot ID | - |
Locus tag | PUW42_RS05660 | Protein ID | WP_274980587.1 |
Coordinates | 1192473..1192733 (+) | Length | 87 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PUW42_RS05640 (PUW42_05640) | 1188245..1189951 | - | 1707 | WP_274980583.1 | terminase large subunit | - |
PUW42_RS05645 (PUW42_05645) | 1189956..1190429 | - | 474 | WP_274980584.1 | P27 family phage terminase small subunit | - |
PUW42_RS05650 (PUW42_05650) | 1191382..1191561 | + | 180 | WP_274980585.1 | hypothetical protein | - |
PUW42_RS05655 (PUW42_05655) | 1191826..1192263 | + | 438 | WP_274980586.1 | hypothetical protein | - |
PUW42_RS05660 (PUW42_05660) | 1192473..1192733 | + | 261 | WP_274980587.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
PUW42_RS05665 (PUW42_05665) | 1192720..1192998 | + | 279 | WP_274980588.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
PUW42_RS05670 (PUW42_05670) | 1193035..1193397 | - | 363 | WP_274980589.1 | HNH endonuclease signature motif containing protein | - |
PUW42_RS05675 (PUW42_05675) | 1193378..1193644 | - | 267 | WP_101659814.1 | hypothetical protein | - |
PUW42_RS05680 (PUW42_05680) | 1193647..1194057 | - | 411 | WP_101659816.1 | sigma-70 family RNA polymerase sigma factor | - |
PUW42_RS05685 (PUW42_05685) | 1194075..1194299 | - | 225 | WP_274980590.1 | helix-turn-helix transcriptional regulator | - |
PUW42_RS05690 (PUW42_05690) | 1194296..1194937 | - | 642 | WP_274980591.1 | hypothetical protein | - |
PUW42_RS05695 (PUW42_05695) | 1194990..1195556 | - | 567 | WP_274980592.1 | helix-turn-helix transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 1166223..1209162 | 42939 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10957.74 Da Isoelectric Point: 8.4650
>T272753 WP_274980588.1 NZ_CP118095:1192720-1192998 [Aerococcus christensenii]
MLKVEQSSEFIKHLKKYVKKHYDMEKLHRAVQALVKQDEQLLKTKYKDHSLNGQLQGLRELHIEGDWLLIYKIDHGKLIL
YLLDTGSHDDLF
MLKVEQSSEFIKHLKKYVKKHYDMEKLHRAVQALVKQDEQLLKTKYKDHSLNGQLQGLRELHIEGDWLLIYKIDHGKLIL
YLLDTGSHDDLF
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|