Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RelE(toxin) |
Location | 1172330..1172813 | Replicon | chromosome |
Accession | NZ_CP118095 | ||
Organism | Aerococcus christensenii strain VSI03 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | PUW42_RS05560 | Protein ID | WP_274980572.1 |
Coordinates | 1172330..1172596 (-) | Length | 89 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | PUW42_RS05565 | Protein ID | WP_274980573.1 |
Coordinates | 1172586..1172813 (-) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PUW42_RS05530 (PUW42_05530) | 1167833..1168702 | - | 870 | WP_274980566.1 | GH25 family lysozyme | - |
PUW42_RS05535 (PUW42_05535) | 1168763..1168966 | - | 204 | WP_274980567.1 | phage holin | - |
PUW42_RS05540 (PUW42_05540) | 1168967..1169260 | - | 294 | WP_274980568.1 | hypothetical protein | - |
PUW42_RS05545 (PUW42_05545) | 1169276..1170106 | - | 831 | WP_274980569.1 | hypothetical protein | - |
PUW42_RS05550 (PUW42_05550) | 1170111..1170419 | - | 309 | WP_274980570.1 | hypothetical protein | - |
PUW42_RS05555 (PUW42_05555) | 1170397..1172280 | - | 1884 | WP_274980571.1 | gp58-like family protein | - |
PUW42_RS05560 (PUW42_05560) | 1172330..1172596 | - | 267 | WP_274980572.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PUW42_RS05565 (PUW42_05565) | 1172586..1172813 | - | 228 | WP_274980573.1 | DUF6290 family protein | Antitoxin |
PUW42_RS05570 (PUW42_05570) | 1172918..1173865 | - | 948 | WP_274980574.1 | hypothetical protein | - |
PUW42_RS05575 (PUW42_05575) | 1173865..1175364 | - | 1500 | WP_274980575.1 | hypothetical protein | - |
PUW42_RS05580 (PUW42_05580) | 1175365..1177236 | - | 1872 | WP_274980576.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 1166223..1209162 | 42939 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 89 a.a. Molecular weight: 10471.58 Da Isoelectric Point: 10.5934
>T272752 WP_274980572.1 NZ_CP118095:c1172596-1172330 [Aerococcus christensenii]
MTYRLVLSKRARKQLKKMDRHVAYMLAKYMKKQLDGLSDPRIYGKALVGDKTGLWRYRLGDYRVICEIKDEQLVILALEI
GHRKLIYK
MTYRLVLSKRARKQLKKMDRHVAYMLAKYMKKQLDGLSDPRIYGKALVGDKTGLWRYRLGDYRVICEIKDEQLVILALEI
GHRKLIYK
Download Length: 267 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|