Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yafQ-relB/YafQ-DinJ |
| Location | 974468..975048 | Replicon | chromosome |
| Accession | NZ_CP118090 | ||
| Organism | Lactobacillus gasseri strain VSI06 | ||
Toxin (Protein)
| Gene name | yafQ | Uniprot ID | A0A249NKC7 |
| Locus tag | PUW64_RS04610 | Protein ID | WP_003647258.1 |
| Coordinates | 974743..975048 (+) | Length | 102 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | A0A249NIV0 |
| Locus tag | PUW64_RS04605 | Protein ID | WP_021314843.1 |
| Coordinates | 974468..974743 (+) | Length | 92 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PUW64_RS04575 (PUW64_04575) | 970347..971237 | - | 891 | WP_003647264.1 | GRP family sugar transporter | - |
| PUW64_RS04580 (PUW64_04580) | 971264..971659 | - | 396 | WP_003647263.1 | D-ribose pyranase | - |
| PUW64_RS04585 (PUW64_04585) | 971768..972217 | - | 450 | WP_003647262.1 | ASCH domain-containing protein | - |
| PUW64_RS04590 (PUW64_04590) | 972220..972984 | - | 765 | Protein_897 | nucleoside phosphorylase | - |
| PUW64_RS04595 (PUW64_04595) | 973111..973599 | - | 489 | WP_003647261.1 | GNAT family N-acetyltransferase | - |
| PUW64_RS04600 (PUW64_04600) | 973602..974135 | - | 534 | WP_003647260.1 | GNAT family N-acetyltransferase | - |
| PUW64_RS04605 (PUW64_04605) | 974468..974743 | + | 276 | WP_021314843.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| PUW64_RS04610 (PUW64_04610) | 974743..975048 | + | 306 | WP_003647258.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
| PUW64_RS04615 (PUW64_04615) | 975211..976026 | - | 816 | WP_003647256.1 | Fic family protein | - |
| PUW64_RS04620 (PUW64_04620) | 976171..976959 | - | 789 | WP_003647255.1 | tyrosine-protein phosphatase | - |
| PUW64_RS04625 (PUW64_04625) | 977028..977297 | - | 270 | WP_225792982.1 | hypothetical protein | - |
| PUW64_RS04630 (PUW64_04630) | 977332..978051 | - | 720 | WP_003647253.1 | hypothetical protein | - |
| PUW64_RS04635 (PUW64_04635) | 978058..978417 | - | 360 | WP_003647252.1 | DUF6176 family protein | - |
| PUW64_RS04640 (PUW64_04640) | 978410..978712 | - | 303 | WP_003647251.1 | MazG-like family protein | - |
| PUW64_RS04645 (PUW64_04645) | 978724..979533 | - | 810 | WP_003647250.1 | DUF2785 domain-containing protein | - |
| PUW64_RS04650 (PUW64_04650) | 979536..979983 | - | 448 | Protein_909 | GNAT family N-acetyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11985.87 Da Isoelectric Point: 10.2029
>T272750 WP_003647258.1 NZ_CP118090:974743-975048 [Lactobacillus gasseri]
MAQINYTPQFKRDYKKLKRKHYDLNKLKNVIQLLIDEKFKILVDKYDDHQLKGSLRSLRALHVEHNKAGNWILVYKIHSG
NLELLTIDLVSTGSHDHTYRT
MAQINYTPQFKRDYKKLKRKHYDLNKLKNVIQLLIDEKFKILVDKYDDHQLKGSLRSLRALHVEHNKAGNWILVYKIHSG
NLELLTIDLVSTGSHDHTYRT
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A249NKC7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A249NIV0 |