Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) yafQ-relB/YafQ-DinJ
Location 974468..975048 Replicon chromosome
Accession NZ_CP118090
Organism Lactobacillus gasseri strain VSI06

Toxin (Protein)


Gene name yafQ Uniprot ID A0A249NKC7
Locus tag PUW64_RS04610 Protein ID WP_003647258.1
Coordinates 974743..975048 (+) Length 102 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A249NIV0
Locus tag PUW64_RS04605 Protein ID WP_021314843.1
Coordinates 974468..974743 (+) Length 92 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PUW64_RS04575 (PUW64_04575) 970347..971237 - 891 WP_003647264.1 GRP family sugar transporter -
PUW64_RS04580 (PUW64_04580) 971264..971659 - 396 WP_003647263.1 D-ribose pyranase -
PUW64_RS04585 (PUW64_04585) 971768..972217 - 450 WP_003647262.1 ASCH domain-containing protein -
PUW64_RS04590 (PUW64_04590) 972220..972984 - 765 Protein_897 nucleoside phosphorylase -
PUW64_RS04595 (PUW64_04595) 973111..973599 - 489 WP_003647261.1 GNAT family N-acetyltransferase -
PUW64_RS04600 (PUW64_04600) 973602..974135 - 534 WP_003647260.1 GNAT family N-acetyltransferase -
PUW64_RS04605 (PUW64_04605) 974468..974743 + 276 WP_021314843.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
PUW64_RS04610 (PUW64_04610) 974743..975048 + 306 WP_003647258.1 type II toxin-antitoxin system YafQ family toxin Toxin
PUW64_RS04615 (PUW64_04615) 975211..976026 - 816 WP_003647256.1 Fic family protein -
PUW64_RS04620 (PUW64_04620) 976171..976959 - 789 WP_003647255.1 tyrosine-protein phosphatase -
PUW64_RS04625 (PUW64_04625) 977028..977297 - 270 WP_225792982.1 hypothetical protein -
PUW64_RS04630 (PUW64_04630) 977332..978051 - 720 WP_003647253.1 hypothetical protein -
PUW64_RS04635 (PUW64_04635) 978058..978417 - 360 WP_003647252.1 DUF6176 family protein -
PUW64_RS04640 (PUW64_04640) 978410..978712 - 303 WP_003647251.1 MazG-like family protein -
PUW64_RS04645 (PUW64_04645) 978724..979533 - 810 WP_003647250.1 DUF2785 domain-containing protein -
PUW64_RS04650 (PUW64_04650) 979536..979983 - 448 Protein_909 GNAT family N-acetyltransferase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, YafQ-like toxin

(3-97)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(1-88)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11985.87 Da        Isoelectric Point: 10.2029

>T272750 WP_003647258.1 NZ_CP118090:974743-975048 [Lactobacillus gasseri]
MAQINYTPQFKRDYKKLKRKHYDLNKLKNVIQLLIDEKFKILVDKYDDHQLKGSLRSLRALHVEHNKAGNWILVYKIHSG
NLELLTIDLVSTGSHDHTYRT

Download         Length: 306 bp

Antitoxin


Download         Length: 92 a.a.        Molecular weight: 10461.79 Da        Isoelectric Point: 4.8096

>AT272750 WP_021314843.1 NZ_CP118090:974468-974743 [Lactobacillus gasseri]
MTTTVSLRLPEDLKKQATDVFNEYGLDWSSAMRMILTQVVSENAIPVNLHRYSEISPSMKSNIDRSLQEYKAGNYKTTNS
VKELFEELDKD

Download         Length: 276 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A249NKC7

Antitoxin

Source ID Structure
AlphaFold DB A0A249NIV0

References