Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) yafQ-relB/YafQ-DinJ
Location 974459..975039 Replicon chromosome
Accession NZ_CP118088
Organism Lactobacillus gasseri strain VSI07

Toxin (Protein)


Gene name yafQ Uniprot ID A0A249NKC7
Locus tag PUW45_RS04600 Protein ID WP_003647258.1
Coordinates 974734..975039 (+) Length 102 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A249NIV0
Locus tag PUW45_RS04595 Protein ID WP_021314843.1
Coordinates 974459..974734 (+) Length 92 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PUW45_RS04565 (PUW45_04565) 970338..971228 - 891 WP_003647264.1 GRP family sugar transporter -
PUW45_RS04570 (PUW45_04570) 971255..971650 - 396 WP_003647263.1 D-ribose pyranase -
PUW45_RS04575 (PUW45_04575) 971759..972208 - 450 WP_003647262.1 ASCH domain-containing protein -
PUW45_RS04580 (PUW45_04580) 972211..972975 - 765 Protein_895 nucleoside phosphorylase -
PUW45_RS04585 (PUW45_04585) 973102..973590 - 489 WP_003647261.1 GNAT family N-acetyltransferase -
PUW45_RS04590 (PUW45_04590) 973593..974126 - 534 WP_003647260.1 GNAT family N-acetyltransferase -
PUW45_RS04595 (PUW45_04595) 974459..974734 + 276 WP_021314843.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
PUW45_RS04600 (PUW45_04600) 974734..975039 + 306 WP_003647258.1 type II toxin-antitoxin system YafQ family toxin Toxin
PUW45_RS04605 (PUW45_04605) 975202..976017 - 816 WP_003647256.1 Fic family protein -
PUW45_RS04610 (PUW45_04610) 976162..976950 - 789 WP_003647255.1 tyrosine-protein phosphatase -
PUW45_RS04615 (PUW45_04615) 977019..977288 - 270 WP_225792982.1 hypothetical protein -
PUW45_RS04620 (PUW45_04620) 977323..978042 - 720 WP_003647253.1 hypothetical protein -
PUW45_RS04625 (PUW45_04625) 978049..978408 - 360 WP_003647252.1 DUF6176 family protein -
PUW45_RS04630 (PUW45_04630) 978401..978703 - 303 WP_003647251.1 MazG-like family protein -
PUW45_RS04635 (PUW45_04635) 978715..979524 - 810 WP_003647250.1 DUF2785 domain-containing protein -
PUW45_RS04640 (PUW45_04640) 979527..979974 - 448 Protein_907 GNAT family N-acetyltransferase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, YafQ-like toxin

(3-97)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(1-88)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11985.87 Da        Isoelectric Point: 10.2029

>T272749 WP_003647258.1 NZ_CP118088:974734-975039 [Lactobacillus gasseri]
MAQINYTPQFKRDYKKLKRKHYDLNKLKNVIQLLIDEKFKILVDKYDDHQLKGSLRSLRALHVEHNKAGNWILVYKIHSG
NLELLTIDLVSTGSHDHTYRT

Download         Length: 306 bp

Antitoxin


Download         Length: 92 a.a.        Molecular weight: 10461.79 Da        Isoelectric Point: 4.8096

>AT272749 WP_021314843.1 NZ_CP118088:974459-974734 [Lactobacillus gasseri]
MTTTVSLRLPEDLKKQATDVFNEYGLDWSSAMRMILTQVVSENAIPVNLHRYSEISPSMKSNIDRSLQEYKAGNYKTTNS
VKELFEELDKD

Download         Length: 276 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A249NKC7

Antitoxin

Source ID Structure
AlphaFold DB A0A249NIV0

References