Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/YafQ-RelB |
Location | 1392362..1392928 | Replicon | chromosome |
Accession | NZ_CP118083 | ||
Organism | Bifidobacterium breve strain VSI11 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A0L7AXF3 |
Locus tag | PUW55_RS06610 | Protein ID | WP_025262990.1 |
Coordinates | 1392635..1392928 (+) | Length | 98 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | PUW55_RS06605 | Protein ID | WP_025221722.1 |
Coordinates | 1392362..1392631 (+) | Length | 90 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PUW55_RS06580 (PUW55_06580) | 1388111..1388797 | - | 687 | WP_013140734.1 | response regulator transcription factor | - |
PUW55_RS06585 (PUW55_06585) | 1388929..1389447 | + | 519 | WP_223261719.1 | hypothetical protein | - |
PUW55_RS06590 (PUW55_06590) | 1389444..1390334 | + | 891 | WP_003831809.1 | hypothetical protein | - |
PUW55_RS06595 (PUW55_06595) | 1390331..1391011 | + | 681 | WP_003829413.1 | ABC transporter ATP-binding protein | - |
PUW55_RS06600 (PUW55_06600) | 1391017..1392177 | + | 1161 | WP_032742829.1 | ABC transporter permease | - |
PUW55_RS06605 (PUW55_06605) | 1392362..1392631 | + | 270 | WP_025221722.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
PUW55_RS06610 (PUW55_06610) | 1392635..1392928 | + | 294 | WP_025262990.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
PUW55_RS06615 (PUW55_06615) | 1393272..1393400 | + | 129 | WP_003829419.1 | hypothetical protein | - |
PUW55_RS06620 (PUW55_06620) | 1393597..1394148 | + | 552 | WP_012577735.1 | RNA polymerase sigma factor | - |
PUW55_RS06625 (PUW55_06625) | 1394182..1395009 | + | 828 | WP_071474967.1 | hypothetical protein | - |
PUW55_RS06630 (PUW55_06630) | 1395141..1395767 | + | 627 | WP_012577737.1 | hypothetical protein | - |
PUW55_RS06635 (PUW55_06635) | 1395764..1396546 | + | 783 | WP_077386957.1 | murein hydrolase transporter LrgB | - |
PUW55_RS06640 (PUW55_06640) | 1396599..1397474 | + | 876 | WP_077386959.1 | ABC transporter ATP-binding protein | - |
PUW55_RS06645 (PUW55_06645) | 1397529..1397927 | + | 399 | WP_015438839.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 1380605..1405141 | 24536 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 98 a.a. Molecular weight: 11190.93 Da Isoelectric Point: 9.7881
>T272748 WP_025262990.1 NZ_CP118083:1392635-1392928 [Bifidobacterium breve]
MLKPDYTAAFQRDIKKLKRKHTDLRPLKEVIRLVLEDTADSKEALRRRHRAHTLTGDLNGVLECHIGNAGDWLLLWIRDD
GTAMFMRTGSHDELLGK
MLKPDYTAAFQRDIKKLKRKHTDLRPLKEVIRLVLEDTADSKEALRRRHRAHTLTGDLNGVLECHIGNAGDWLLLWIRDD
GTAMFMRTGSHDELLGK
Download Length: 294 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|