Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mazEF/DinJ(antitoxin)
Location 1158168..1158801 Replicon chromosome
Accession NZ_CP118083
Organism Bifidobacterium breve strain VSI11

Toxin (Protein)


Gene name mazF Uniprot ID -
Locus tag PUW55_RS05230 Protein ID WP_274982764.1
Coordinates 1158433..1158801 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name mazE Uniprot ID -
Locus tag PUW55_RS05225 Protein ID WP_174773700.1
Coordinates 1158168..1158452 (+) Length 95 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PUW55_RS05180 (PUW55_05180) 1154093..1154320 + 228 WP_025221588.1 helix-turn-helix transcriptional regulator -
PUW55_RS05185 (PUW55_05185) 1154533..1155147 + 615 WP_274982763.1 lysozyme -
PUW55_RS05190 (PUW55_05190) 1155237..1155398 + 162 WP_155245937.1 hypothetical protein -
PUW55_RS05195 (PUW55_05195) 1155395..1155739 + 345 WP_014484967.1 hypothetical protein -
PUW55_RS05200 (PUW55_05200) 1155855..1156196 + 342 WP_071477984.1 hypothetical protein -
PUW55_RS05205 (PUW55_05205) 1156395..1157180 + 786 WP_012577858.1 hypothetical protein -
PUW55_RS05210 (PUW55_05210) 1157182..1157523 + 342 WP_012577857.1 hypothetical protein -
PUW55_RS05215 (PUW55_05215) 1157523..1157705 + 183 WP_052789116.1 hypothetical protein -
PUW55_RS05220 (PUW55_05220) 1157793..1158092 + 300 WP_012577856.1 hypothetical protein -
PUW55_RS05225 (PUW55_05225) 1158168..1158452 + 285 WP_174773700.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
PUW55_RS05230 (PUW55_05230) 1158433..1158801 + 369 WP_274982764.1 type II toxin-antitoxin system PemK/MazF family toxin Toxin
PUW55_RS05235 (PUW55_05235) 1158989..1159534 + 546 WP_274982765.1 hypothetical protein -
PUW55_RS05240 (PUW55_05240) 1159531..1159758 + 228 WP_274982766.1 hypothetical protein -
PUW55_RS05245 (PUW55_05245) 1159755..1159991 + 237 WP_131234413.1 hypothetical protein -
PUW55_RS05250 (PUW55_05250) 1159988..1160188 + 201 WP_131234414.1 hypothetical protein -
PUW55_RS05255 (PUW55_05255) 1160281..1161513 + 1233 WP_274982767.1 Fic/DOC family N-terminal domain-containing protein -
PUW55_RS05260 (PUW55_05260) 1161672..1161947 - 276 WP_131234415.1 hypothetical protein -
PUW55_RS05265 (PUW55_05265) 1162045..1162371 - 327 WP_274982768.1 hypothetical protein -
PUW55_RS05270 (PUW55_05270) 1162368..1162637 - 270 WP_131187413.1 hypothetical protein -
PUW55_RS05275 (PUW55_05275) 1162634..1163158 - 525 WP_071477971.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1122694..1184264 61570


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(16-111)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(5-53)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13795.67 Da        Isoelectric Point: 4.6916

>T272747 WP_274982764.1 NZ_CP118083:1158433-1158801 [Bifidobacterium breve]
MTSTPSEPRLYDVWLMWVEFPDHPGIGKPRPVVITEVDGDLVSGIVAKITGNTDWDEAGDVPLLDWKAEGLAKPSLVRCS
QRFYFNKSELLQWFGRLSLRDAEHVNDGLQATLDIPPYRRSV

Download         Length: 369 bp

Antitoxin


Download         Length: 95 a.a.        Molecular weight: 10488.80 Da        Isoelectric Point: 5.0057

>AT272747 WP_174773700.1 NZ_CP118083:1158168-1158452 [Bifidobacterium breve]
MGKLVANIDDDVKARAAALYDSMGMSLSTAVNMFLRQSLVDNGLPFKPTRHTPDGYPVPPVHNAYMFERSEKGHVILPAD
WNDSEDSVYDQYAK

Download         Length: 285 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References