Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/RelB(antitoxin) |
| Location | 1093288..1093927 | Replicon | chromosome |
| Accession | NZ_CP118083 | ||
| Organism | Bifidobacterium breve strain VSI11 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | A0A133L4T2 |
| Locus tag | PUW55_RS04860 | Protein ID | WP_021649636.1 |
| Coordinates | 1093288..1093644 (-) | Length | 119 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | - |
| Locus tag | PUW55_RS04865 | Protein ID | WP_003829235.1 |
| Coordinates | 1093631..1093927 (-) | Length | 99 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PUW55_RS04835 (PUW55_04835) | 1089164..1089946 | - | 783 | WP_021649638.1 | gamma-glutamyl-gamma-aminobutyrate hydrolase family protein | - |
| PUW55_RS04840 (PUW55_04840) | 1090084..1090569 | - | 486 | WP_021649637.1 | cytidine deaminase | - |
| PUW55_RS04845 (PUW55_04845) | 1090685..1091956 | - | 1272 | WP_065457984.1 | IS30 family transposase | - |
| PUW55_RS04850 (PUW55_04850) | 1092048..1092404 | + | 357 | WP_012577924.1 | SdpI family protein | - |
| PUW55_RS04855 (PUW55_04855) | 1092509..1093111 | + | 603 | WP_003829233.1 | transglutaminase family protein | - |
| PUW55_RS04860 (PUW55_04860) | 1093288..1093644 | - | 357 | WP_021649636.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| PUW55_RS04865 (PUW55_04865) | 1093631..1093927 | - | 297 | WP_003829235.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| PUW55_RS04870 (PUW55_04870) | 1094176..1094850 | + | 675 | WP_015438748.1 | histidine phosphatase family protein | - |
| PUW55_RS04875 (PUW55_04875) | 1094933..1095316 | + | 384 | WP_016463075.1 | DUF948 domain-containing protein | - |
| PUW55_RS04880 (PUW55_04880) | 1095316..1095552 | + | 237 | WP_003829239.1 | hypothetical protein | - |
| PUW55_RS04885 (PUW55_04885) | 1095648..1098326 | + | 2679 | WP_021649635.1 | alanine--tRNA ligase | - |
| PUW55_RS04890 (PUW55_04890) | 1098335..1098787 | + | 453 | WP_021649634.1 | Holliday junction resolvase RuvX | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 1090685..1091956 | 1271 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 119 a.a. Molecular weight: 13332.27 Da Isoelectric Point: 8.9603
>T272746 WP_021649636.1 NZ_CP118083:c1093644-1093288 [Bifidobacterium breve]
MMKTDPRQFEIWWVPFAFPDKPGKAKNRPSVILQWDDGTRIALVTKVTGNTWRDEPGYVVLRDWQDAGLSKPSAVRCSQL
LRLPSNLFLDDGPTGRLSAYDAGRVTWAINELYPGLLA
MMKTDPRQFEIWWVPFAFPDKPGKAKNRPSVILQWDDGTRIALVTKVTGNTWRDEPGYVVLRDWQDAGLSKPSAVRCSQL
LRLPSNLFLDDGPTGRLSAYDAGRVTWAINELYPGLLA
Download Length: 357 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|