Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Xre-MNT/HTH_26(antitoxin) |
Location | 666726..667834 | Replicon | chromosome |
Accession | NZ_CP118080 | ||
Organism | Streptococcus agalactiae strain VSI14 |
Toxin (Protein)
Gene name | MNTss | Uniprot ID | A0A3S8RBH6 |
Locus tag | PUW74_RS03600 | Protein ID | WP_071661597.1 |
Coordinates | 666965..667834 (+) | Length | 290 a.a. |
Antitoxin (Protein)
Gene name | Xress | Uniprot ID | - |
Locus tag | PUW74_RS03595 | Protein ID | WP_000205227.1 |
Coordinates | 666726..666950 (+) | Length | 75 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PUW74_RS03560 (PUW74_03560) | 661942..662112 | + | 171 | WP_004614788.1 | cysteine-rich KTR domain-containing protein | - |
PUW74_RS03565 (PUW74_03565) | 662315..662485 | + | 171 | WP_000713595.1 | hypothetical protein | - |
PUW74_RS03570 (PUW74_03570) | 662499..663101 | + | 603 | WP_001062586.1 | recombinase family protein | - |
PUW74_RS03575 (PUW74_03575) | 663117..663794 | + | 678 | Protein_621 | DNA topoisomerase | - |
PUW74_RS03580 (PUW74_03580) | 664150..664602 | + | 453 | WP_223804552.1 | DNA recombinase | - |
PUW74_RS03585 (PUW74_03585) | 664603..665019 | + | 417 | WP_000323438.1 | recombinase | - |
PUW74_RS03590 (PUW74_03590) | 665039..666583 | + | 1545 | WP_002390960.1 | recombinase family protein | - |
PUW74_RS03595 (PUW74_03595) | 666726..666950 | + | 225 | WP_000205227.1 | helix-turn-helix transcriptional regulator | Antitoxin |
PUW74_RS03600 (PUW74_03600) | 666965..667834 | + | 870 | WP_071661597.1 | nucleotidyltransferase domain-containing protein | Toxin |
PUW74_RS03605 (PUW74_03605) | 667815..668549 | + | 735 | WP_000662263.1 | class I SAM-dependent methyltransferase | - |
PUW74_RS03610 (PUW74_03610) | 668582..669490 | + | 909 | WP_001255866.1 | aminoglycoside nucleotidyltransferase ANT(6)-Ia | - |
PUW74_RS03615 (PUW74_03615) | 669487..669687 | + | 201 | Protein_629 | hypothetical protein | - |
PUW74_RS03620 (PUW74_03620) | 669767..670929 | + | 1163 | WP_088186165.1 | IS3-like element ISSag12 family transposase | - |
PUW74_RS03625 (PUW74_03625) | 671088..671339 | + | 252 | Protein_631 | GNAT family N-acetyltransferase | - |
PUW74_RS03630 (PUW74_03630) | 671432..672226 | + | 795 | WP_001096887.1 | aminoglycoside O-phosphotransferase APH(3')-IIIa | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | tet(O) / ant(6)-Ia / aph(3')-III / erm(B) | gbs0628 / gbs0630 | 605961..712193 | 106232 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 290 a.a. Molecular weight: 32902.55 Da Isoelectric Point: 4.9770
>T272744 WP_071661597.1 NZ_CP118080:666965-667834 [Streptococcus agalactiae]
MVGNVIQIVTEKLSSLPFIEGIVLGGSRARGTHTENSDIDIGIYYNSDSFDLTAINQIATELDDKNRNNLVVPPGAWGDW
INGGGWLFINGYHVDLILRDIKRVEQIIKDTEQGIVTANYQTGHPHGYISAMYRGELAISKILYAKNESLCELKKQAEIY
PTALKKSLMNFFIFEAEFSLMFVKANAGVEDKYYIAGHVFRIISCLNQVLFACNNAYCINEKKAIKLLETFEHKPEKYTE
KVNHIFEVLGISLFECYDMTEKLYKEVNEIVSEINNFLNEESSDERKQI
MVGNVIQIVTEKLSSLPFIEGIVLGGSRARGTHTENSDIDIGIYYNSDSFDLTAINQIATELDDKNRNNLVVPPGAWGDW
INGGGWLFINGYHVDLILRDIKRVEQIIKDTEQGIVTANYQTGHPHGYISAMYRGELAISKILYAKNESLCELKKQAEIY
PTALKKSLMNFFIFEAEFSLMFVKANAGVEDKYYIAGHVFRIISCLNQVLFACNNAYCINEKKAIKLLETFEHKPEKYTE
KVNHIFEVLGISLFECYDMTEKLYKEVNEIVSEINNFLNEESSDERKQI
Download Length: 870 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|