Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/RelB(antitoxin) |
Location | 249727..250339 | Replicon | chromosome |
Accession | NZ_CP118079 | ||
Organism | Streptococcus agalactiae strain VSI15 |
Toxin (Protein)
Gene name | parE | Uniprot ID | A0A8G2N8L3 |
Locus tag | PUW77_RS01450 | Protein ID | WP_000384860.1 |
Coordinates | 249727..250062 (-) | Length | 112 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | Q8E7D2 |
Locus tag | PUW77_RS01455 | Protein ID | WP_000259017.1 |
Coordinates | 250052..250339 (-) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PUW77_RS01425 (PUW77_01425) | 244925..245566 | + | 642 | WP_000591144.1 | hypothetical protein | - |
PUW77_RS01430 (PUW77_01430) | 245866..246741 | + | 876 | WP_000421240.1 | hypothetical protein | - |
PUW77_RS01435 (PUW77_01435) | 246777..247211 | + | 435 | WP_001220479.1 | hypothetical protein | - |
PUW77_RS01440 (PUW77_01440) | 247528..248784 | + | 1257 | WP_000122836.1 | MobV family relaxase | - |
PUW77_RS01445 (PUW77_01445) | 248952..249422 | + | 471 | WP_000130119.1 | hypothetical protein | - |
PUW77_RS01450 (PUW77_01450) | 249727..250062 | - | 336 | WP_000384860.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PUW77_RS01455 (PUW77_01455) | 250052..250339 | - | 288 | WP_000259017.1 | hypothetical protein | Antitoxin |
PUW77_RS01460 (PUW77_01460) | 250846..251136 | + | 291 | WP_000078283.1 | WXG100 family type VII secretion target | - |
PUW77_RS01465 (PUW77_01465) | 251238..251644 | + | 407 | Protein_233 | hypothetical protein | - |
PUW77_RS01470 (PUW77_01470) | 251644..252204 | + | 561 | WP_001865562.1 | hypothetical protein | - |
PUW77_RS01475 (PUW77_01475) | 252177..252857 | + | 681 | WP_001865565.1 | hypothetical protein | - |
PUW77_RS01480 (PUW77_01480) | 252842..253228 | + | 387 | WP_000259069.1 | hypothetical protein | - |
PUW77_RS01485 (PUW77_01485) | 253262..253543 | + | 282 | WP_000052406.1 | hypothetical protein | - |
PUW77_RS01490 (PUW77_01490) | 254375..255235 | + | 861 | WP_000477654.1 | Rgg/GadR/MutR family transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | - | 241758..250613 | 8855 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 13227.87 Da Isoelectric Point: 4.5348
>T272738 WP_000384860.1 NZ_CP118079:c250062-249727 [Streptococcus agalactiae]
MDYKKYQIIYAPDVLEKLKEIRDYISQNYSSTSGQRKMEQIINDIEKLEVFPEVGFDADEKYGSEISNYHSTRGYTLSKD
YIVLYHIEEEENSVVIDYLLPTRSDYMKLFK
MDYKKYQIIYAPDVLEKLKEIRDYISQNYSSTSGQRKMEQIINDIEKLEVFPEVGFDADEKYGSEISNYHSTRGYTLSKD
YIVLYHIEEEENSVVIDYLLPTRSDYMKLFK
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|