Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 1927267..1927735 Replicon chromosome
Accession NZ_CP118060
Organism Staphylococcus haemolyticus strain VSI35

Toxin (Protein)


Gene name TsaT Uniprot ID Q4L4Q4
Locus tag PUW68_RS09540 Protein ID WP_011276326.1
Coordinates 1927547..1927735 (+) Length 63 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID -
Locus tag PUW68_RS09535 Protein ID WP_070441716.1
Coordinates 1927267..1927524 (+) Length 86 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PUW68_RS09500 (PUW68_09500) 1922431..1923156 - 726 WP_070581525.1 type I 3-dehydroquinate dehydratase -
PUW68_RS09505 (PUW68_09505) 1923319..1923741 + 423 WP_016931015.1 organic hydroperoxide resistance protein -
PUW68_RS09510 (PUW68_09510) 1924018..1924509 + 492 WP_070581526.1 GNAT family N-acetyltransferase -
PUW68_RS09515 (PUW68_09515) 1924640..1925256 + 617 Protein_1840 LysE family transporter -
PUW68_RS09520 (PUW68_09520) 1925443..1926051 - 609 WP_070581527.1 histidine phosphatase family protein -
PUW68_RS09525 (PUW68_09525) 1926279..1926521 + 243 WP_011276324.1 hypothetical protein -
PUW68_RS09530 (PUW68_09530) 1926513..1926716 - 204 WP_070441713.1 sterile alpha motif-like domain-containing protein -
PUW68_RS09535 (PUW68_09535) 1927267..1927524 + 258 WP_070441716.1 hypothetical protein Antitoxin
PUW68_RS09540 (PUW68_09540) 1927547..1927735 + 189 WP_011276326.1 hypothetical protein Toxin
PUW68_RS09545 (PUW68_09545) 1927853..1928434 + 582 WP_070581528.1 lipoprotein N-acylation protein LnsA -
PUW68_RS09550 (PUW68_09550) 1928481..1928717 - 237 WP_016931008.1 hypothetical protein -
PUW68_RS09555 (PUW68_09555) 1928878..1929624 + 747 WP_070581529.1 membrane lipoprotein lipid attachment site-containing protein -
PUW68_RS09560 (PUW68_09560) 1929694..1930302 - 609 WP_053024265.1 GNAT family N-acetyltransferase -
PUW68_RS09565 (PUW68_09565) 1930439..1931185 + 747 WP_070581531.1 poly-gamma-glutamate hydrolase family protein -
PUW68_RS09570 (PUW68_09570) 1931261..1931548 + 288 WP_016931004.1 hypothetical protein -
PUW68_RS09575 (PUW68_09575) 1931788..1932012 + 225 WP_070581532.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7110.80 Da        Isoelectric Point: 9.6269

>T272734 WP_011276326.1 NZ_CP118060:1927547-1927735 [Staphylococcus haemolyticus]
MSLHLTILLWLGIIFVIAASIILGLLLKSKKEERKESYLGFTVIFYIFGFALLIYVFIFGIL

Download         Length: 189 bp

Antitoxin


Download         Length: 86 a.a.        Molecular weight: 9850.85 Da        Isoelectric Point: 4.0625

>AT272734 WP_070441716.1 NZ_CP118060:1927267-1927524 [Staphylococcus haemolyticus]
MNNNKIFWINIFITLLFLGFNIIVTYNADLDDFFWLIPGLTISGITIVLSLSTALICKNLVSEVIFLINIAMLLYYIYPI
VYTFF

Download         Length: 258 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2A1KAB5

Antitoxin

Source ID Structure

References