Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 846371..846903 | Replicon | chromosome |
| Accession | NZ_CP118060 | ||
| Organism | Staphylococcus haemolyticus strain VSI35 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | Q4L7V3 |
| Locus tag | PUW68_RS04215 | Protein ID | WP_011275272.1 |
| Coordinates | 846538..846903 (+) | Length | 122 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | - |
| Locus tag | PUW68_RS04210 | Protein ID | WP_049426542.1 |
| Coordinates | 846371..846541 (+) | Length | 57 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PUW68_RS04185 (PUW68_04185) | 842157..842636 | + | 480 | WP_070580730.1 | PH domain-containing protein | - |
| PUW68_RS04190 (PUW68_04190) | 842629..844152 | + | 1524 | WP_242305279.1 | PH domain-containing protein | - |
| PUW68_RS04195 (PUW68_04195) | 844145..844672 | + | 528 | WP_070580727.1 | PH domain-containing protein | - |
| PUW68_RS04200 (PUW68_04200) | 844682..845041 | + | 360 | WP_070580725.1 | holo-ACP synthase | - |
| PUW68_RS04205 (PUW68_04205) | 845137..846285 | + | 1149 | WP_049426543.1 | alanine racemase | - |
| PUW68_RS04210 (PUW68_04210) | 846371..846541 | + | 171 | WP_049426542.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
| PUW68_RS04215 (PUW68_04215) | 846538..846903 | + | 366 | WP_011275272.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| PUW68_RS04220 (PUW68_04220) | 847211..848212 | + | 1002 | WP_053020219.1 | PP2C family protein-serine/threonine phosphatase | - |
| PUW68_RS04225 (PUW68_04225) | 848311..848637 | + | 327 | WP_049426540.1 | anti-sigma factor antagonist | - |
| PUW68_RS04230 (PUW68_04230) | 848666..849118 | + | 453 | WP_049426550.1 | anti-sigma B factor RsbW | - |
| PUW68_RS04235 (PUW68_04235) | 849093..849863 | + | 771 | WP_011275276.1 | RNA polymerase sigma factor SigB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 122 a.a. Molecular weight: 13672.75 Da Isoelectric Point: 8.4121
>T272732 WP_011275272.1 NZ_CP118060:846538-846903 [Staphylococcus haemolyticus]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYRLDKDSVILLEQIR
TLDKKRLKEKLTYLSDEKMQEVDEALDISLGLHDEVKTQNT
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYRLDKDSVILLEQIR
TLDKKRLKEKLTYLSDEKMQEVDEALDISLGLHDEVKTQNT
Download Length: 366 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|