Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | pemIK/MazF(toxin) |
| Location | 2536114..2536765 | Replicon | chromosome |
| Accession | NZ_CP118050 | ||
| Organism | Lacticaseibacillus rhamnosus strain VSI43 | ||
Toxin (Protein)
| Gene name | pemK | Uniprot ID | K8Q4Y0 |
| Locus tag | PUW66_RS11705 | Protein ID | WP_005686631.1 |
| Coordinates | 2536114..2536497 (-) | Length | 128 a.a. |
Antitoxin (Protein)
| Gene name | pemI | Uniprot ID | K8QH19 |
| Locus tag | PUW66_RS11710 | Protein ID | WP_005686632.1 |
| Coordinates | 2536517..2536765 (-) | Length | 83 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PUW66_RS11700 (PUW66_11700) | 2535176..2535703 | - | 528 | WP_049152640.1 | QueT transporter family protein | - |
| PUW66_RS11705 (PUW66_11705) | 2536114..2536497 | - | 384 | WP_005686631.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| PUW66_RS11710 (PUW66_11710) | 2536517..2536765 | - | 249 | WP_005686632.1 | antitoxin | Antitoxin |
| PUW66_RS11715 (PUW66_11715) | 2536877..2538016 | - | 1140 | WP_005691215.1 | alanine racemase | - |
| PUW66_RS11720 (PUW66_11720) | 2538003..2538377 | - | 375 | WP_005686634.1 | holo-ACP synthase | - |
| PUW66_RS11725 (PUW66_11725) | 2538546..2540054 | - | 1509 | WP_005686635.1 | DEAD/DEAH box helicase | - |
| PUW66_RS11730 (PUW66_11730) | 2540328..2541716 | - | 1389 | WP_014571607.1 | UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D- alanine ligase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | - | 2523247..2594233 | 70986 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 13757.03 Da Isoelectric Point: 10.9764
>T272727 WP_005686631.1 NZ_CP118050:c2536497-2536114 [Lacticaseibacillus rhamnosus]
MDVTVKRGDVFFADLSPVVGSEQGGNRPVLIIQNNVGNHYSPTVIVAAITSKIQKPKMPTHVGLRAKQDGVERNSVILLE
QIRTIDKQRLQARVTALSSAKMAAVDRALAISVGLVSLPKPKTYNKN
MDVTVKRGDVFFADLSPVVGSEQGGNRPVLIIQNNVGNHYSPTVIVAAITSKIQKPKMPTHVGLRAKQDGVERNSVILLE
QIRTIDKQRLQARVTALSSAKMAAVDRALAISVGLVSLPKPKTYNKN
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|