Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PRK09907(toxin) |
| Location | 2439470..2440035 | Replicon | chromosome |
| Accession | NZ_CP118050 | ||
| Organism | Lacticaseibacillus rhamnosus strain VSI43 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | C2JYM4 |
| Locus tag | PUW66_RS11225 | Protein ID | WP_005692155.1 |
| Coordinates | 2439470..2439817 (-) | Length | 116 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | - |
| Locus tag | PUW66_RS11230 | Protein ID | WP_020752297.1 |
| Coordinates | 2439817..2440035 (-) | Length | 73 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PUW66_RS11205 (PUW66_11205) | 2434965..2436206 | - | 1242 | WP_005692160.1 | acyltransferase | - |
| PUW66_RS11210 (PUW66_11210) | 2436203..2436904 | - | 702 | WP_005692159.1 | ATP-binding cassette domain-containing protein | - |
| PUW66_RS11215 (PUW66_11215) | 2436897..2437715 | - | 819 | WP_275016710.1 | ABC transporter permease subunit | - |
| PUW66_RS11220 (PUW66_11220) | 2437956..2438624 | - | 669 | WP_005692157.1 | phenylalanine--tRNA ligase beta subunit-related protein | - |
| PUW66_RS11225 (PUW66_11225) | 2439470..2439817 | - | 348 | WP_005692155.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| PUW66_RS11230 (PUW66_11230) | 2439817..2440035 | - | 219 | WP_020752297.1 | hypothetical protein | Antitoxin |
| PUW66_RS11235 (PUW66_11235) | 2440129..2441964 | - | 1836 | WP_015764721.1 | ABC transporter ATP-binding protein | - |
| PUW66_RS11240 (PUW66_11240) | 2441951..2443741 | - | 1791 | WP_015764722.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 13150.01 Da Isoelectric Point: 7.9817
>T272726 WP_005692155.1 NZ_CP118050:c2439817-2439470 [Lacticaseibacillus rhamnosus]
MTYKAKQGDVVWLDFDPSEGHEIRKRCPAVVLSSNAYNRATGFVIVAPITSTIRTLPGYVDIVSNKIRGQVVTSQVYSLD
VTEQGNRKIDFIERMNIEDFYTVAQFTKMNFDFKF
MTYKAKQGDVVWLDFDPSEGHEIRKRCPAVVLSSNAYNRATGFVIVAPITSTIRTLPGYVDIVSNKIRGQVVTSQVYSLD
VTEQGNRKIDFIERMNIEDFYTVAQFTKMNFDFKF
Download Length: 348 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|