Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ImmA-IrrE/HTH_19(antitoxin) |
Location | 2309681..2310720 | Replicon | chromosome |
Accession | NZ_CP118048 | ||
Organism | Enterococcus faecalis strain VSI48 |
Toxin (Protein)
Gene name | IrrE | Uniprot ID | - |
Locus tag | PUW76_RS11005 | Protein ID | WP_010824179.1 |
Coordinates | 2310061..2310720 (+) | Length | 220 a.a. |
Antitoxin (Protein)
Gene name | ImmA | Uniprot ID | - |
Locus tag | PUW76_RS11000 | Protein ID | WP_010824178.1 |
Coordinates | 2309681..2310064 (+) | Length | 128 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PUW76_RS10945 (2305509) | 2305509..2305877 | - | 369 | WP_002365216.1 | DUF86 domain-containing protein | - |
PUW76_RS10950 (2305861) | 2305861..2306193 | - | 333 | WP_002399122.1 | nucleotidyltransferase domain-containing protein | - |
PUW76_RS10955 (2306253) | 2306253..2306576 | - | 324 | WP_002399121.1 | hypothetical protein | - |
PUW76_RS10960 (2306616) | 2306616..2306777 | - | 162 | WP_229236153.1 | hypothetical protein | - |
PUW76_RS10965 (2306866) | 2306866..2307018 | - | 153 | WP_002399525.1 | hypothetical protein | - |
PUW76_RS10970 (2307045) | 2307045..2307269 | - | 225 | WP_010824177.1 | hypothetical protein | - |
PUW76_RS10975 (2307501) | 2307501..2307689 | + | 189 | WP_002365223.1 | hypothetical protein | - |
PUW76_RS10980 (2307676) | 2307676..2307837 | - | 162 | WP_002365224.1 | hypothetical protein | - |
PUW76_RS10985 (2307860) | 2307860..2308276 | - | 417 | WP_002408315.1 | DUF961 family protein | - |
PUW76_RS10990 (2308276) | 2308276..2308602 | - | 327 | WP_010710084.1 | hypothetical protein | - |
PUW76_RS10995 (2308688) | 2308688..2308939 | - | 252 | WP_010777935.1 | hypothetical protein | - |
PUW76_RS11000 (2309681) | 2309681..2310064 | + | 384 | WP_010824178.1 | helix-turn-helix transcriptional regulator | Antitoxin |
PUW76_RS11005 (2310061) | 2310061..2310720 | + | 660 | WP_010824179.1 | ImmA/IrrE family metallo-endopeptidase | Toxin |
PUW76_RS11010 (2310736) | 2310736..2311071 | + | 336 | WP_010824180.1 | helix-turn-helix domain-containing protein | - |
PUW76_RS11015 (2311109) | 2311109..2312440 | - | 1332 | WP_010824181.1 | FAD-dependent oxidoreductase | - |
PUW76_RS11020 (2312540) | 2312540..2313475 | - | 936 | WP_174115432.1 | aldo/keto reductase | - |
PUW76_RS11025 (2313490) | 2313490..2313909 | - | 420 | WP_002365234.1 | MerR family transcriptional regulator | - |
PUW76_RS11030 (2313926) | 2313926..2314507 | - | 582 | WP_002380883.1 | histidine phosphatase family protein | - |
PUW76_RS11035 (2314729) | 2314729..2315058 | + | 330 | WP_010816770.1 | helix-turn-helix domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | - | 2270907..2317241 | 46334 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 220 a.a. Molecular weight: 26320.31 Da Isoelectric Point: 7.0496
>T272721 WP_010824179.1 NZ_CP118048:2310061-2310720 [Enterococcus faecalis]
MIGLLWVDFISKKLYFEAFNFSNKLIKEVSYYSSKNIEQVKCFDIEKYVKEVEDVEFVEYTFQKQLKRRMLGSISKVDDE
VIITTNKELMLERKNFTKMHEVMHYYIDIPKINNATHTFSDILLKNGYLMEDFPKEYRANVGASMLMANDQALFYALKKF
YSFEEIAQYFFMSKSALRNRLIEHLIYVNNCTFAHANTLFNNYYFHKETDIYRFIFNDS
MIGLLWVDFISKKLYFEAFNFSNKLIKEVSYYSSKNIEQVKCFDIEKYVKEVEDVEFVEYTFQKQLKRRMLGSISKVDDE
VIITTNKELMLERKNFTKMHEVMHYYIDIPKINNATHTFSDILLKNGYLMEDFPKEYRANVGASMLMANDQALFYALKKF
YSFEEIAQYFFMSKSALRNRLIEHLIYVNNCTFAHANTLFNNYYFHKETDIYRFIFNDS
Download Length: 660 bp
Antitoxin
Download Length: 128 a.a. Molecular weight: 15032.08 Da Isoelectric Point: 5.3750
>AT272721 WP_010824178.1 NZ_CP118048:2309681-2310064 [Enterococcus faecalis]
VQPLAKRLQLLREEKEWTKTYVAKQLGLNNLGTYANWEYGTREPDSEMLSKIASLYDVSTDFLLGRTEERIHLNDKEKIG
KNIISHFRLNTSDMDIEDIEELEEELIDFQDFLIKKAKEKKKRNKKD
VQPLAKRLQLLREEKEWTKTYVAKQLGLNNLGTYANWEYGTREPDSEMLSKIASLYDVSTDFLLGRTEERIHLNDKEKIG
KNIISHFRLNTSDMDIEDIEELEEELIDFQDFLIKKAKEKKKRNKKD
Download Length: 384 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|