Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | sezT-pezT/zeta-couple_hipB |
Location | 316112..317349 | Replicon | chromosome |
Accession | NZ_CP118046 | ||
Organism | Streptococcus anginosus strain VSI52 |
Toxin (Protein)
Gene name | sezT | Uniprot ID | A0A412PQB6 |
Locus tag | PUW62_RS01655 | Protein ID | WP_007517267.1 |
Coordinates | 316591..317349 (+) | Length | 253 a.a. |
Antitoxin (Protein)
Gene name | pezT | Uniprot ID | - |
Locus tag | PUW62_RS01650 | Protein ID | WP_003069299.1 |
Coordinates | 316112..316588 (+) | Length | 159 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PUW62_RS01605 (PUW62_01605) | 311411..311647 | + | 237 | WP_003069318.1 | DUF5965 family protein | - |
PUW62_RS01610 (PUW62_01610) | 311644..312039 | + | 396 | WP_007517275.1 | DUF5945 family protein | - |
PUW62_RS01615 (PUW62_01615) | 312225..312506 | + | 282 | WP_003069315.1 | hypothetical protein | - |
PUW62_RS01620 (PUW62_01620) | 312789..312971 | + | 183 | WP_224783947.1 | hypothetical protein | - |
PUW62_RS01625 (PUW62_01625) | 313055..313327 | - | 273 | Protein_284 | DUF5960 family protein | - |
PUW62_RS01630 (PUW62_01630) | 313314..313681 | - | 368 | Protein_285 | hypothetical protein | - |
PUW62_RS01635 (PUW62_01635) | 313678..315083 | - | 1406 | Protein_286 | Y-family DNA polymerase | - |
PUW62_RS01640 (PUW62_01640) | 315088..315222 | - | 135 | WP_003069303.1 | hypothetical protein | - |
PUW62_RS01645 (PUW62_01645) | 315225..315917 | - | 693 | WP_007517269.1 | XRE family transcriptional regulator | - |
PUW62_RS01650 (PUW62_01650) | 316112..316588 | + | 477 | WP_003069299.1 | type II toxin-antitoxin system antitoxin PezA | Antitoxin |
PUW62_RS01655 (PUW62_01655) | 316591..317349 | + | 759 | WP_007517267.1 | type II toxin-antitoxin system toxin PezT | Toxin |
PUW62_RS01660 (PUW62_01660) | 317402..318688 | + | 1287 | WP_007517265.1 | SIR2 family protein | - |
PUW62_RS01665 (PUW62_01665) | 318681..319877 | + | 1197 | WP_274997270.1 | DUF87 domain-containing protein | - |
PUW62_RS01670 (PUW62_01670) | 319879..320367 | + | 489 | WP_274997272.1 | ATP-binding protein | - |
PUW62_RS01675 (PUW62_01675) | 320719..321081 | + | 363 | WP_007517263.1 | SAG1252 family conjugative relaxosome accessory protein | - |
PUW62_RS01680 (PUW62_01680) | 321084..321449 | + | 366 | WP_007517258.1 | MobC family plasmid mobilization relaxosome protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 253 a.a. Molecular weight: 28657.64 Da Isoelectric Point: 6.3918
>T272715 WP_007517267.1 NZ_CP118046:316591-317349 [Streptococcus anginosus]
MIADFSTADFDLALKRTIRSLTRGKIASPEPKAILLGGQSGAGKTTIHRIKQKEFQGNIIIIDGDSYRSLHPNYLALQEK
YGKDSVDYTKGFAGKMVEHLVDELSKQGYHLLIEGTLRTTEVPRKTAILLKSRDYQVSLALIATKPELSYLSTLIRYEEL
FAIVPNQARATPKDHHDGIVNHLVDNLRELENDQLFDYIQIYQRDRSCVYDSETDDGSAADVLQNCLLGKWSKVEKEMLK
VDQERLREMQEL
MIADFSTADFDLALKRTIRSLTRGKIASPEPKAILLGGQSGAGKTTIHRIKQKEFQGNIIIIDGDSYRSLHPNYLALQEK
YGKDSVDYTKGFAGKMVEHLVDELSKQGYHLLIEGTLRTTEVPRKTAILLKSRDYQVSLALIATKPELSYLSTLIRYEEL
FAIVPNQARATPKDHHDGIVNHLVDNLRELENDQLFDYIQIYQRDRSCVYDSETDDGSAADVLQNCLLGKWSKVEKEMLK
VDQERLREMQEL
Download Length: 759 bp
Antitoxin
Download Length: 159 a.a. Molecular weight: 18000.39 Da Isoelectric Point: 4.4289
>AT272715 WP_003069299.1 NZ_CP118046:316112-316588 [Streptococcus anginosus]
MIGENIKSLRKTHDLTQPEFAKIIGISRNSLSRYENGTSSVSTELIDRICQKFNVSYVDIVGGEKMLTPVEDYQLTLKIE
VIKERGAAILAQLYRYQDSQGIAFDDETNPWILMSDDLSVQINTKIYLVDTFDEVERYNGYLDGIERMLEVASHQVVA
MIGENIKSLRKTHDLTQPEFAKIIGISRNSLSRYENGTSSVSTELIDRICQKFNVSYVDIVGGEKMLTPVEDYQLTLKIE
VIKERGAAILAQLYRYQDSQGIAFDDETNPWILMSDDLSVQINTKIYLVDTFDEVERYNGYLDGIERMLEVASHQVVA
Download Length: 477 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|