Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 2022016..2022545 | Replicon | chromosome |
Accession | NZ_CP118044 | ||
Organism | Staphylococcus aureus strain VSI56 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | PUW46_RS09885 | Protein ID | WP_000621175.1 |
Coordinates | 2022016..2022378 (-) | Length | 121 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | T1YCG8 |
Locus tag | PUW46_RS09890 | Protein ID | WP_000948331.1 |
Coordinates | 2022375..2022545 (-) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PUW46_RS09865 (PUW46_09865) | 2018980..2019750 | - | 771 | WP_001041102.1 | RNA polymerase sigma factor SigB | - |
PUW46_RS09870 (PUW46_09870) | 2019725..2020204 | - | 480 | WP_001190829.1 | anti-sigma B factor RsbW | - |
PUW46_RS09875 (PUW46_09875) | 2020206..2020532 | - | 327 | WP_001052491.1 | anti-sigma factor antagonist | - |
PUW46_RS09880 (PUW46_09880) | 2020651..2021667 | - | 1017 | WP_275009411.1 | PP2C family protein-serine/threonine phosphatase | - |
PUW46_RS09885 (PUW46_09885) | 2022016..2022378 | - | 363 | WP_000621175.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
PUW46_RS09890 (PUW46_09890) | 2022375..2022545 | - | 171 | WP_000948331.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
PUW46_RS09895 (PUW46_09895) | 2022630..2023778 | - | 1149 | WP_001281142.1 | alanine racemase | - |
PUW46_RS09900 (PUW46_09900) | 2023844..2024203 | - | 360 | WP_000581197.1 | holo-ACP synthase | - |
PUW46_RS09905 (PUW46_09905) | 2024207..2024698 | - | 492 | WP_001205910.1 | PH domain-containing protein | - |
PUW46_RS09910 (PUW46_09910) | 2024685..2026268 | - | 1584 | WP_001294626.1 | PH domain-containing protein | - |
PUW46_RS09915 (PUW46_09915) | 2026261..2026740 | - | 480 | WP_001287090.1 | hypothetical protein | - |
PUW46_RS09920 (PUW46_09920) | 2026949..2027509 | - | 561 | WP_001092402.1 | K(+)-transporting ATPase subunit C | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13441.69 Da Isoelectric Point: 10.1654
>T272710 WP_000621175.1 NZ_CP118044:c2022378-2022016 [Staphylococcus aureus]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|