Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tsbAT/- |
Location | 1868562..1869338 | Replicon | chromosome |
Accession | NZ_CP118044 | ||
Organism | Staphylococcus aureus strain VSI56 |
Toxin (Protein)
Gene name | tsbT | Uniprot ID | X5E2E6 |
Locus tag | PUW46_RS08990 | Protein ID | WP_000031108.1 |
Coordinates | 1868562..1868714 (-) | Length | 51 a.a. |
Antitoxin (Protein)
Gene name | tsbA | Uniprot ID | - |
Locus tag | PUW46_RS08995 | Protein ID | WP_001251229.1 |
Coordinates | 1868739..1869338 (-) | Length | 200 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PUW46_RS08975 (PUW46_08975) | 1864478..1865299 | + | 822 | WP_000669376.1 | RluA family pseudouridine synthase | - |
PUW46_RS08980 (PUW46_08980) | 1865752..1867137 | - | 1386 | WP_000116231.1 | class II fumarate hydratase | - |
PUW46_RS08985 (PUW46_08985) | 1867333..1867728 | - | 396 | WP_000901023.1 | hypothetical protein | - |
PUW46_RS08990 (PUW46_08990) | 1868562..1868714 | - | 153 | WP_000031108.1 | SAS053 family protein | Toxin |
PUW46_RS08995 (PUW46_08995) | 1868739..1869338 | - | 600 | WP_001251229.1 | glucosamine-6-phosphate isomerase | Antitoxin |
PUW46_RS09000 (PUW46_09000) | 1869496..1869966 | - | 471 | WP_000181394.1 | tRNA (uridine(34)/cytosine(34)/5- carboxymethylaminomethyluridine(34)-2'-O)- methyltransferase TrmL | - |
PUW46_RS09005 (PUW46_09005) | 1869971..1871098 | - | 1128 | WP_000379985.1 | tRNA epoxyqueuosine(34) reductase QueG | - |
PUW46_RS09010 (PUW46_09010) | 1871249..1871971 | - | 723 | WP_000590809.1 | amino acid ABC transporter ATP-binding protein | - |
PUW46_RS09015 (PUW46_09015) | 1871964..1873421 | - | 1458 | WP_000649913.1 | ABC transporter permease subunit | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5936.28 Da Isoelectric Point: 3.8962
>T272709 WP_000031108.1 NZ_CP118044:c1868714-1868562 [Staphylococcus aureus]
MSKDKDPKLNYHEEENSMVTDFEDLKELGKEMEQISDQNDQEKNSEEDSQ
MSKDKDPKLNYHEEENSMVTDFEDLKELGKEMEQISDQNDQEKNSEEDSQ
Download Length: 153 bp
Antitoxin
Download Length: 200 a.a. Molecular weight: 22329.45 Da Isoelectric Point: 5.1445
>AT272709 WP_001251229.1 NZ_CP118044:c1869338-1868739 [Staphylococcus aureus]
MAMNFKVFDNSQLVAEYAADIIRKQFNNNPTTIAGFHLDTDQAPVLDELKKNVEKHAVDFSQINILDYDDKKSYFEGLGV
PAGQVYPIAYEKDAIELIADKIKTKENKGKLTLQVVSIDEQGKLNVSIRQGLMEAREIFLVVTGANKRDVVEKLYQENGK
TSFEPADLKAHRMVNVILDKEAAAGLPEDVKAYFTSRFA
MAMNFKVFDNSQLVAEYAADIIRKQFNNNPTTIAGFHLDTDQAPVLDELKKNVEKHAVDFSQINILDYDDKKSYFEGLGV
PAGQVYPIAYEKDAIELIADKIKTKENKGKLTLQVVSIDEQGKLNVSIRQGLMEAREIFLVVTGANKRDVVEKLYQENGK
TSFEPADLKAHRMVNVILDKEAAAGLPEDVKAYFTSRFA
Download Length: 600 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|