Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 827698..828175 Replicon chromosome
Accession NZ_CP118044
Organism Staphylococcus aureus strain VSI56

Toxin (Protein)


Gene name TsaT Uniprot ID T1Y7S2
Locus tag PUW46_RS03965 Protein ID WP_000052076.1
Coordinates 827698..827886 (-) Length 63 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID T1Y6P8
Locus tag PUW46_RS03970 Protein ID WP_001059690.1
Coordinates 827915..828175 (-) Length 87 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PUW46_RS03930 (PUW46_03930) 823279..824325 + 1047 WP_000247473.1 CHAP domain-containing protein -
PUW46_RS03935 (PUW46_03935) 824332..824922 + 591 WP_000810443.1 hypothetical protein -
PUW46_RS03940 (PUW46_03940) 824978..825319 + 342 WP_209038265.1 lipoprotein -
PUW46_RS03945 (PUW46_03945) 825428..825931 + 504 WP_275015178.1 helix-turn-helix domain-containing protein -
PUW46_RS03950 (PUW46_03950) 825960..826448 + 489 WP_164022204.1 IS30 family transposase -
PUW46_RS03955 (PUW46_03955) 826668..826853 - 186 Protein_766 hypothetical protein -
PUW46_RS03960 (PUW46_03960) 826941..827510 - 570 WP_001106654.1 lipoprotein N-acylation protein LnsA -
PUW46_RS03965 (PUW46_03965) 827698..827886 - 189 WP_000052076.1 hypothetical protein Toxin
PUW46_RS03970 (PUW46_03970) 827915..828175 - 261 WP_001059690.1 hypothetical protein Antitoxin
PUW46_RS03975 (PUW46_03975) 828516..828719 + 204 WP_000145163.1 sterile alpha motif-like domain-containing protein -
PUW46_RS03980 (PUW46_03980) 828716..828952 - 237 WP_000368687.1 hypothetical protein -
PUW46_RS03985 (PUW46_03985) 829177..829758 + 582 WP_001140693.1 histidine phosphatase family protein -
PUW46_RS03990 (PUW46_03990) 829831..830448 - 618 WP_000255561.1 LysE/ArgO family amino acid transporter -
PUW46_RS03995 (PUW46_03995) 830603..831097 - 495 WP_000569884.1 GNAT family N-acetyltransferase -
PUW46_RS04000 (PUW46_04000) 831496..831918 - 423 WP_000974460.1 organic hydroperoxide resistance protein -
PUW46_RS04005 (PUW46_04005) 832066..832782 + 717 WP_000150012.1 type I 3-dehydroquinate dehydratase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - vWbp 787895..836042 48147


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7142.82 Da        Isoelectric Point: 9.9971

>T272707 WP_000052076.1 NZ_CP118044:c827886-827698 [Staphylococcus aureus]
MSLHFAILFWLALIFLVAATFILVLMKKTGKESKKESYLSFTVILYIFGFAILIYTFIFGVL

Download         Length: 189 bp

Antitoxin


Download         Length: 87 a.a.        Molecular weight: 9940.09 Da        Isoelectric Point: 4.0624

>AT272707 WP_001059690.1 NZ_CP118044:c828175-827915 [Staphylococcus aureus]
MNNILLNAINIVITTTFVIFNILITYNKDLDDLCWLLPGIIICGVILIVSFTIAMITKNWLSEILFFINIVLVLYYIYPI
FYSFIG

Download         Length: 261 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0VP18

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0VN56

References