Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) omega-epsilon-zeta/zeta-epsilon
Location 680041..680584 Replicon chromosome
Accession NZ_CP118043
Organism Streptococcus agalactiae strain VSI63

Toxin (Protein)


Gene name zeta Uniprot ID A0A1X9I2P4
Locus tag PUW57_RS03830 Protein ID WP_002943355.1
Coordinates 680315..680584 (+) Length 90 a.a.

Antitoxin (Protein)


Gene name epsilon Uniprot ID Q9AL19
Locus tag PUW57_RS03825 Protein ID WP_002326825.1
Coordinates 680041..680313 (+) Length 91 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PUW57_RS03790 (PUW57_03790) 675891..676130 + 240 WP_150352943.1 peptide-binding protein -
PUW57_RS03795 (PUW57_03795) 676206..677228 + 1023 WP_162841140.1 IS30 family transposase -
PUW57_RS03800 (PUW57_03800) 677356..677439 + 84 WP_001814874.1 23S rRNA methyltransferase attenuation leader peptide -
PUW57_RS03805 (PUW57_03805) 677564..678301 + 738 WP_001038790.1 23S rRNA (adenine(2058)-N(6))-methyltransferase Erm(B) -
PUW57_RS03810 (PUW57_03810) 678471..678731 + 261 Protein_667 topoisomerase DNA-binding C4 zinc finger domain-containing protein -
PUW57_RS03815 (PUW57_03815) 678820..679716 + 897 WP_002326827.1 ParA family protein -
PUW57_RS03820 (PUW57_03820) 679808..680023 + 216 WP_001835296.1 peptide-binding protein -
PUW57_RS03825 (PUW57_03825) 680041..680313 + 273 WP_002326825.1 antitoxin Antitoxin
PUW57_RS03830 (PUW57_03830) 680315..680584 + 270 WP_002943355.1 zeta toxin family protein Toxin
PUW57_RS03835 (PUW57_03835) 680682..681003 + 322 Protein_672 DUF4368 domain-containing protein -
PUW57_RS03840 (PUW57_03840) 680996..681955 + 960 Protein_673 hypothetical protein -
PUW57_RS03845 (PUW57_03845) 682026..682325 + 300 WP_024408864.1 DUF5962 family protein -
PUW57_RS03850 (PUW57_03850) 682339..682629 + 291 WP_024408865.1 DUF5966 family protein -
PUW57_RS03855 (PUW57_03855) 682725..683355 + 631 Protein_676 peptidylprolyl isomerase -
PUW57_RS03860 (PUW57_03860) 683395..684471 + 1077 WP_027971256.1 toprim domain-containing protein -
PUW57_RS03865 (PUW57_03865) 684525..684752 + 228 WP_023370180.1 DUF5965 family protein -
PUW57_RS03870 (PUW57_03870) 684749..685138 + 390 WP_032458613.1 DUF5945 family protein -
PUW57_RS03875 (PUW57_03875) 685188..685478 + 291 WP_032458612.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element tet(O) / erm(B) cylX / cylD / cylG / acpC / cylZ / cylA / cylB / cylE / cylF / cylI / cylJ / cylK 589539..756764 167225
- flank IS/Tn erm(B) - 676206..678301 2095


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Zeta toxin domain

(27-75)

Antitoxin

Bacterial epsilon antitoxin

(2-90)


Sequences

Toxin        


Download         Length: 90 a.a.        Molecular weight: 9999.08 Da        Isoelectric Point: 8.7696

>T272704 WP_002943355.1 NZ_CP118043:680315-680584 [Streptococcus agalactiae]
MANITDFTEKQFEDRLEKNVERLTKNRLAVESPTAFLLGGQPGSGKTSLRSAISEETQGNVVIIDNDTFKQQHPRSTFAN
VNKRNNFNS

Download         Length: 270 bp

Antitoxin


Download         Length: 91 a.a.        Molecular weight: 10720.17 Da        Isoelectric Point: 4.4865

>AT272704 WP_002326825.1 NZ_CP118043:680041-680313 [Streptococcus agalactiae]
MAVTYEKTFEIEIINELSASVYNRVLNYVLNHELDTKNTRLLEVNLLNQLEVAQEVDLFQQPFEELQAIHEYWRSMNQYS
KQILTKEKVA

Download         Length: 273 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1X9I2P4

Antitoxin

Source ID Structure
AlphaFold DB A0A0M2AF93

References